Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RDE8

Protein Details
Accession A0A1X7RDE8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-119LTNTSTKAGKQKRRESGQGGRYRHydrophilic
NLS Segment(s)
PositionSequence
108-109KR
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MVSSKVDKTPSKKKKGGVFSDMNLGLGFSPDPSAEPEPRTGAIGMFDRFRGRSSRSVAPSSAVKPRTAEAPARRAYKPRDQDTRMKDLGEDDTTQDLTNTSTKAGKQKRRESGQGGRYRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.77
4 0.74
5 0.69
6 0.6
7 0.61
8 0.54
9 0.45
10 0.35
11 0.27
12 0.19
13 0.14
14 0.12
15 0.05
16 0.06
17 0.06
18 0.07
19 0.1
20 0.14
21 0.16
22 0.17
23 0.19
24 0.2
25 0.2
26 0.21
27 0.17
28 0.13
29 0.13
30 0.14
31 0.14
32 0.12
33 0.13
34 0.13
35 0.13
36 0.14
37 0.15
38 0.16
39 0.21
40 0.25
41 0.31
42 0.33
43 0.35
44 0.34
45 0.33
46 0.31
47 0.28
48 0.29
49 0.24
50 0.2
51 0.19
52 0.19
53 0.2
54 0.2
55 0.24
56 0.22
57 0.28
58 0.33
59 0.37
60 0.37
61 0.4
62 0.43
63 0.46
64 0.51
65 0.51
66 0.55
67 0.56
68 0.63
69 0.64
70 0.67
71 0.58
72 0.5
73 0.42
74 0.36
75 0.34
76 0.28
77 0.23
78 0.16
79 0.17
80 0.18
81 0.17
82 0.15
83 0.12
84 0.12
85 0.13
86 0.12
87 0.12
88 0.14
89 0.17
90 0.28
91 0.37
92 0.45
93 0.53
94 0.63
95 0.71
96 0.76
97 0.81
98 0.8
99 0.8
100 0.8
101 0.79