Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RQB8

Protein Details
Accession A0A1X7RQB8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-82LLEGRKKREAKRQQKEQQRRIKEEDBasic
NLS Segment(s)
PositionSequence
62-73RKKREAKRQQKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035213  DUF5321  
Pfam View protein in Pfam  
PF17254  DUF5321  
Amino Acid Sequences MLNFTRQTDAKLELLREVVQKVKNGEDVDVKQALGTGDPEHEKEWEQVMKELEETDMLLEGRKKREAKRQQKEQQRRIKEEDDVRAAQPAPAEGASEAQKTSQPKFLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.23
5 0.25
6 0.24
7 0.27
8 0.27
9 0.28
10 0.3
11 0.28
12 0.28
13 0.28
14 0.27
15 0.28
16 0.26
17 0.24
18 0.19
19 0.19
20 0.17
21 0.12
22 0.11
23 0.08
24 0.09
25 0.1
26 0.12
27 0.11
28 0.12
29 0.13
30 0.13
31 0.15
32 0.15
33 0.15
34 0.16
35 0.17
36 0.16
37 0.15
38 0.14
39 0.11
40 0.09
41 0.08
42 0.05
43 0.05
44 0.05
45 0.05
46 0.08
47 0.11
48 0.14
49 0.2
50 0.24
51 0.28
52 0.39
53 0.5
54 0.58
55 0.65
56 0.74
57 0.77
58 0.84
59 0.9
60 0.9
61 0.89
62 0.86
63 0.82
64 0.78
65 0.73
66 0.69
67 0.64
68 0.61
69 0.56
70 0.5
71 0.43
72 0.4
73 0.36
74 0.3
75 0.24
76 0.18
77 0.14
78 0.12
79 0.12
80 0.1
81 0.12
82 0.14
83 0.15
84 0.14
85 0.14
86 0.18
87 0.21
88 0.24