Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RY37

Protein Details
Accession A0A1X7RY37   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-34TSAERNERARLRRRKNLRSARLAANRHydrophilic
NLS Segment(s)
PositionSequence
16-35RARLRRRKNLRSARLAANRR
Subcellular Location(s) nucl 10.5, mito 7, cyto_nucl 6.5, extr 3, E.R. 2, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSVRDINTSAERNERARLRRRKNLRSARLAANRRRNVLAYVANPLFVASVMLLPPPRPLPPSCLRAPLALLTVLYYRNYNLRGLDLGYLSLLTLLDLPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.45
4 0.53
5 0.61
6 0.64
7 0.71
8 0.8
9 0.83
10 0.86
11 0.89
12 0.87
13 0.86
14 0.81
15 0.81
16 0.8
17 0.78
18 0.76
19 0.76
20 0.71
21 0.64
22 0.6
23 0.52
24 0.44
25 0.39
26 0.34
27 0.24
28 0.26
29 0.23
30 0.22
31 0.2
32 0.18
33 0.14
34 0.1
35 0.09
36 0.03
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.08
44 0.08
45 0.11
46 0.12
47 0.18
48 0.24
49 0.29
50 0.29
51 0.33
52 0.33
53 0.31
54 0.31
55 0.25
56 0.21
57 0.16
58 0.14
59 0.1
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.13
66 0.15
67 0.16
68 0.15
69 0.16
70 0.17
71 0.17
72 0.18
73 0.15
74 0.13
75 0.12
76 0.11
77 0.09
78 0.08
79 0.07
80 0.05
81 0.06