Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RWA5

Protein Details
Accession A0A1X7RWA5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-37SEEVKSLRKNKTWRLKKRAEVSRNGKKVHydrophilic
NLS Segment(s)
PositionSequence
16-50LRKNKTWRLKKRAEVSRNGKKVLPGRWVFKLKRGP
Subcellular Location(s) cyto 14, cyto_nucl 11, nucl 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013103  RVT_2  
Pfam View protein in Pfam  
PF07727  RVT_2  
Amino Acid Sequences MWSEWKDAMSEEVKSLRKNKTWRLKKRAEVSRNGKKVLPGRWVFKLKRGPNGEILKYKARWVVKGYAQEEGSDYTETFASVVKPMSYKALFAIAAALDLEIEQMDVKTAFLYGLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.39
4 0.44
5 0.51
6 0.59
7 0.63
8 0.71
9 0.78
10 0.81
11 0.83
12 0.84
13 0.87
14 0.87
15 0.83
16 0.82
17 0.81
18 0.81
19 0.77
20 0.7
21 0.61
22 0.56
23 0.55
24 0.5
25 0.49
26 0.42
27 0.41
28 0.46
29 0.53
30 0.48
31 0.5
32 0.54
33 0.48
34 0.53
35 0.54
36 0.49
37 0.49
38 0.54
39 0.49
40 0.43
41 0.43
42 0.38
43 0.34
44 0.33
45 0.29
46 0.25
47 0.24
48 0.24
49 0.26
50 0.25
51 0.32
52 0.31
53 0.3
54 0.3
55 0.28
56 0.25
57 0.22
58 0.2
59 0.13
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.07
67 0.07
68 0.08
69 0.08
70 0.09
71 0.09
72 0.15
73 0.14
74 0.14
75 0.14
76 0.16
77 0.15
78 0.14
79 0.15
80 0.09
81 0.09
82 0.09
83 0.08
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07