Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZRN3

Protein Details
Accession G8ZRN3   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ASSLPHPKIVKKHTKKFKRHHSDRYKRVSENBasic
NLS Segment(s)
PositionSequence
9-37KIVKKHTKKFKRHHSDRYKRVSENWRKQK
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tdl:TDEL_0C02860  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASSLPHPKIVKKHTKKFKRHHSDRYKRVSENWRKQKGIDSVVRRRFRGNIDEPNIGYGSNKKTKFLSPSGHKVFLVANIKDLEVLTMHTKSYAAEIAHNVSSKNRVPILARAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.93
9 0.93
10 0.93
11 0.93
12 0.92
13 0.87
14 0.78
15 0.77
16 0.77
17 0.76
18 0.76
19 0.77
20 0.75
21 0.69
22 0.68
23 0.68
24 0.63
25 0.59
26 0.56
27 0.54
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.47
36 0.43
37 0.43
38 0.43
39 0.45
40 0.42
41 0.4
42 0.36
43 0.28
44 0.22
45 0.16
46 0.17
47 0.22
48 0.22
49 0.22
50 0.24
51 0.26
52 0.31
53 0.32
54 0.34
55 0.32
56 0.41
57 0.44
58 0.44
59 0.41
60 0.37
61 0.33
62 0.31
63 0.31
64 0.22
65 0.2
66 0.19
67 0.19
68 0.19
69 0.18
70 0.13
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.17
88 0.15
89 0.2
90 0.21
91 0.23
92 0.22
93 0.22
94 0.24
95 0.33
96 0.4
97 0.4
98 0.39
99 0.35
100 0.36
101 0.36
102 0.34
103 0.3
104 0.23
105 0.23
106 0.31
107 0.38
108 0.43
109 0.41
110 0.43
111 0.42