Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7S4L9

Protein Details
Accession A0A1X7S4L9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-40SHKQDEAEIKKRRPRRRSPAPRRPNPRRHNSSYGPBasic
NLS Segment(s)
PositionSequence
15-50KKRRPRRRSPAPRRPNPRRHNSSYGPPPRRPAARRA
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPTNTSHKQDEAEIKKRRPRRRSPAPRRPNPRRHNSSYGPPPRRPAARRAPSSYDQPPTRELPRREEKRSSFSQDVPGLVHSTSRENSKTEKYQPQPDDSDRSRIDAWLEAQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.75
4 0.8
5 0.8
6 0.82
7 0.83
8 0.86
9 0.89
10 0.92
11 0.94
12 0.95
13 0.94
14 0.94
15 0.94
16 0.93
17 0.92
18 0.91
19 0.89
20 0.85
21 0.83
22 0.77
23 0.75
24 0.75
25 0.76
26 0.71
27 0.65
28 0.61
29 0.58
30 0.61
31 0.54
32 0.52
33 0.53
34 0.55
35 0.58
36 0.59
37 0.6
38 0.54
39 0.57
40 0.53
41 0.48
42 0.41
43 0.37
44 0.35
45 0.32
46 0.36
47 0.38
48 0.36
49 0.38
50 0.47
51 0.52
52 0.55
53 0.6
54 0.58
55 0.56
56 0.59
57 0.58
58 0.51
59 0.46
60 0.47
61 0.4
62 0.37
63 0.32
64 0.27
65 0.21
66 0.17
67 0.17
68 0.11
69 0.14
70 0.15
71 0.18
72 0.19
73 0.2
74 0.25
75 0.31
76 0.37
77 0.41
78 0.5
79 0.52
80 0.6
81 0.62
82 0.63
83 0.63
84 0.61
85 0.62
86 0.55
87 0.57
88 0.48
89 0.48
90 0.43
91 0.37
92 0.35
93 0.3