Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RLK6

Protein Details
Accession A0A1X7RLK6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-70RCWGGRCLGFRSKRKKRTLLLHydrophilic
NLS Segment(s)
PositionSequence
62-65KRKK
Subcellular Location(s) plas 13, mito 7, E.R. 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLLVRSCAVLLIPASNSSHSLVVLILFVAMVEVLRIGCKFHFCDAAERRRCWGGRCLGFRSKRKKRTLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.13
6 0.11
7 0.11
8 0.09
9 0.08
10 0.08
11 0.06
12 0.04
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.03
22 0.03
23 0.04
24 0.04
25 0.07
26 0.08
27 0.1
28 0.14
29 0.15
30 0.24
31 0.3
32 0.41
33 0.45
34 0.45
35 0.46
36 0.48
37 0.49
38 0.43
39 0.44
40 0.43
41 0.45
42 0.49
43 0.53
44 0.56
45 0.64
46 0.7
47 0.73
48 0.75
49 0.76
50 0.81