FuNGI

G8ZN22

Protein Details

Accession

G8ZN22

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
24-54	DFQRYHEKLNRKLQKLRHRCQLVNKNTKKYS	Hydrophilic
90-111	EMLKLRARQRGRFKSNEKKVVG	Hydrophilic

NLS Segment(s)

Position	Sequence
95-113	RARQRGRFKSNEKKVVGTR

Subcellular Location(s)

nucl 14, cyto_nucl 13, cyto 8, mito 1, plas 1, pero 1, E.R. 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR026258 SRP68 IPR034652 SRP68-RBD IPR038253 SRP68_N_sf
Gene Ontology	GO:0005730 C:nucleolus GO:0005786 C:signal recognition particle, endoplasmic reticulum targeting GO:0008312 F:7S RNA binding GO:0030942 F:endoplasmic reticulum signal peptide binding GO:0005047 F:signal recognition particle binding GO:0006614 P:SRP-dependent cotranslational protein targeting to membrane
KEGG	tdl:TDEL_0A06840 -
Pfam	View protein in Pfam PF16969 SRP68
CDD	cd15481 SRP68-RBD

Amino Acid Sequences

MGAFSPIVATYGSRVEQLLETPQDFQRYHEKLNRKLQKLRHRCQLVNKNTKKYSANEKYDKITSADYDKKSKLYGVLVLLHAERDLALSEMLKLRARQRGRFKSNEKKVVGTRLKKAVKTSQNLVELTINEKLWITRAQYIIYARLAQAEYLLNGKFSKDKESGKIARNLAVCFAALSHLCKSDALPETVYEFLQSKYDYSLKQHAGKIISASDLQNFIVTQVRAAEQEDDELAKLILANGFKAELPDIEMEKGVSIKKIEYRAFIAQVNDPQVEQLINEAENIQATSPAQFSERLLKWQQALEKQEIRTSYHEEGDDEEEGINSHENDQILLVYIKFNVLFASILRDDNLAGFSFSQFERSTKNILKSLREVMELPGVYSDDELLAQLQLCQAYYEAKISFRLAYVHAEKYHYRNSLALYLHSLEILDNAVANAGEVSEYSLPGDLLTKTTIENLRNNIMQKLKEVMALAEYEKSVADVFRSPYDPSVIEQLGSGPIEPARIRLDNLFPLRPKMRPVQSKPSLFDLAFNYIDYESESAPSNDYDNESKPVQDAEVEQDQEPTKKRGFLGLFGR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.15
3	0.16
4	0.18
5	0.22
6	0.22
7	0.23
8	0.25
9	0.28
10	0.32
11	0.32
12	0.33
13	0.37
14	0.38
15	0.45
16	0.5
17	0.57
18	0.6
19	0.71
20	0.77
21	0.74
22	0.78
23	0.8
24	0.82
25	0.84
26	0.83
27	0.83
28	0.81
29	0.79
30	0.82
31	0.83
32	0.82
33	0.83
34	0.83
35	0.82
36	0.77
37	0.78
38	0.71
39	0.66
40	0.66
41	0.65
42	0.67
43	0.65
44	0.65
45	0.65
46	0.63
47	0.6
48	0.51
49	0.43
50	0.36
51	0.36
52	0.41
53	0.4
54	0.43
55	0.43
56	0.43
57	0.42
58	0.41
59	0.36
60	0.3
61	0.3
62	0.27
63	0.28
64	0.27
65	0.27
66	0.25
67	0.22
68	0.19
69	0.14
70	0.11
71	0.08
72	0.08
73	0.07
74	0.07
75	0.07
76	0.09
77	0.13
78	0.15
79	0.17
80	0.2
81	0.25
82	0.34
83	0.39
84	0.46
85	0.54
86	0.62
87	0.68
88	0.75
89	0.79
90	0.81
91	0.85
92	0.86
93	0.77
94	0.72
95	0.69
96	0.7
97	0.69
98	0.65
99	0.61
100	0.62
101	0.65
102	0.62
103	0.63
104	0.62
105	0.61
106	0.6
107	0.59
108	0.56
109	0.56
110	0.53
111	0.49
112	0.42
113	0.34
114	0.31
115	0.28
116	0.21
117	0.16
118	0.16
119	0.14
120	0.14
121	0.17
122	0.17
123	0.19
124	0.2
125	0.2
126	0.23
127	0.25
128	0.25
129	0.23
130	0.21
131	0.16
132	0.18
133	0.18
134	0.14
135	0.14
136	0.12
137	0.11
138	0.13
139	0.13
140	0.11
141	0.11
142	0.12
143	0.14
144	0.14
145	0.2
146	0.23
147	0.27
148	0.3
149	0.39
150	0.45
151	0.47
152	0.53
153	0.48
154	0.48
155	0.47
156	0.43
157	0.35
158	0.28
159	0.22
160	0.15
161	0.14
162	0.1
163	0.09
164	0.11
165	0.11
166	0.11
167	0.12
168	0.12
169	0.12
170	0.17
171	0.2
172	0.19
173	0.18
174	0.17
175	0.19
176	0.2
177	0.19
178	0.13
179	0.11
180	0.1
181	0.12
182	0.11
183	0.1
184	0.12
185	0.16
186	0.16
187	0.19
188	0.26
189	0.28
190	0.33
191	0.35
192	0.35
193	0.34
194	0.33
195	0.3
196	0.23
197	0.2
198	0.16
199	0.15
200	0.12
201	0.12
202	0.11
203	0.1
204	0.09
205	0.09
206	0.11
207	0.11
208	0.1
209	0.1
210	0.11
211	0.11
212	0.12
213	0.12
214	0.08
215	0.09
216	0.09
217	0.09
218	0.08
219	0.08
220	0.07
221	0.05
222	0.05
223	0.05
224	0.06
225	0.06
226	0.06
227	0.06
228	0.07
229	0.07
230	0.07
231	0.07
232	0.05
233	0.07
234	0.08
235	0.09
236	0.08
237	0.09
238	0.08
239	0.08
240	0.09
241	0.08
242	0.08
243	0.07
244	0.08
245	0.12
246	0.18
247	0.19
248	0.19
249	0.23
250	0.23
251	0.25
252	0.25
253	0.23
254	0.19
255	0.2
256	0.2
257	0.17
258	0.15
259	0.12
260	0.11
261	0.1
262	0.08
263	0.07
264	0.05
265	0.05
266	0.05
267	0.06
268	0.05
269	0.05
270	0.05
271	0.04
272	0.04
273	0.04
274	0.05
275	0.05
276	0.05
277	0.06
278	0.07
279	0.07
280	0.15
281	0.15
282	0.19
283	0.2
284	0.21
285	0.22
286	0.23
287	0.26
288	0.24
289	0.26
290	0.27
291	0.3
292	0.29
293	0.3
294	0.29
295	0.28
296	0.26
297	0.28
298	0.24
299	0.22
300	0.22
301	0.2
302	0.2
303	0.2
304	0.18
305	0.13
306	0.11
307	0.09
308	0.09
309	0.09
310	0.08
311	0.05
312	0.06
313	0.07
314	0.07
315	0.08
316	0.07
317	0.07
318	0.07
319	0.08
320	0.07
321	0.05
322	0.06
323	0.06
324	0.06
325	0.06
326	0.05
327	0.05
328	0.05
329	0.05
330	0.1
331	0.1
332	0.1
333	0.11
334	0.11
335	0.1
336	0.11
337	0.12
338	0.07
339	0.06
340	0.06
341	0.06
342	0.08
343	0.08
344	0.11
345	0.1
346	0.11
347	0.14
348	0.16
349	0.22
350	0.25
351	0.29
352	0.31
353	0.33
354	0.35
355	0.35
356	0.39
357	0.34
358	0.31
359	0.28
360	0.24
361	0.26
362	0.23
363	0.19
364	0.14
365	0.13
366	0.12
367	0.11
368	0.1
369	0.05
370	0.05
371	0.05
372	0.05
373	0.05
374	0.05
375	0.05
376	0.06
377	0.06
378	0.06
379	0.06
380	0.06
381	0.08
382	0.08
383	0.11
384	0.11
385	0.11
386	0.13
387	0.14
388	0.14
389	0.13
390	0.14
391	0.13
392	0.18
393	0.2
394	0.23
395	0.23
396	0.26
397	0.27
398	0.31
399	0.36
400	0.32
401	0.29
402	0.28
403	0.28
404	0.31
405	0.3
406	0.26
407	0.22
408	0.22
409	0.2
410	0.19
411	0.16
412	0.1
413	0.1
414	0.09
415	0.06
416	0.05
417	0.05
418	0.05
419	0.05
420	0.05
421	0.04
422	0.03
423	0.03
424	0.03
425	0.06
426	0.06
427	0.06
428	0.07
429	0.07
430	0.07
431	0.07
432	0.09
433	0.07
434	0.08
435	0.09
436	0.1
437	0.09
438	0.15
439	0.19
440	0.21
441	0.25
442	0.28
443	0.31
444	0.34
445	0.35
446	0.35
447	0.35
448	0.33
449	0.3
450	0.31
451	0.27
452	0.26
453	0.25
454	0.2
455	0.17
456	0.17
457	0.16
458	0.13
459	0.12
460	0.1
461	0.1
462	0.1
463	0.09
464	0.08
465	0.09
466	0.11
467	0.14
468	0.17
469	0.19
470	0.2
471	0.21
472	0.24
473	0.22
474	0.2
475	0.24
476	0.21
477	0.19
478	0.18
479	0.17
480	0.17
481	0.16
482	0.15
483	0.1
484	0.1
485	0.13
486	0.13
487	0.15
488	0.18
489	0.19
490	0.2
491	0.23
492	0.27
493	0.32
494	0.37
495	0.4
496	0.37
497	0.43
498	0.45
499	0.44
500	0.45
501	0.46
502	0.51
503	0.56
504	0.62
505	0.66
506	0.71
507	0.75
508	0.73
509	0.7
510	0.65
511	0.54
512	0.5
513	0.43
514	0.39
515	0.33
516	0.3
517	0.25
518	0.21
519	0.21
520	0.18
521	0.16
522	0.11
523	0.12
524	0.14
525	0.13
526	0.15
527	0.15
528	0.15
529	0.15
530	0.19
531	0.22
532	0.23
533	0.26
534	0.26
535	0.26
536	0.25
537	0.25
538	0.21
539	0.19
540	0.18
541	0.21
542	0.27
543	0.28
544	0.27
545	0.3
546	0.32
547	0.36
548	0.38
549	0.37
550	0.34
551	0.36
552	0.37
553	0.42
554	0.42

G8ZN22

3D AlphaFold-predicted Structure Viewer