Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RPW7

Protein Details
Accession A0A1X7RPW7    Localization Confidence High Confidence Score 21.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-36DTDSHYAHRRSRRPHRPAHSADHLPBasic
94-116AEYQKRRRREFEKAKAKRRREEEBasic
242-266EDEDERRYARRRPGRSRSRRAVDVSBasic
NLS Segment(s)
PositionSequence
20-45RRSRRPHRPAHSADHLPRRGARPRRT
98-118KRRRREFEKAKAKRRREEERW
182-233RSGKGERAKSMSGKSEKAKSRSGQSERAKSRSGQSERAKSRSGKSERARSRA
247-261RRYARRRPGRSRSRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSPSSYYSHDSDTDSHYAHRRSRRPHRPAHSADHLPRRGARPRRTGSAPASHETSNSRSAAANFGKIALGVVFVQLVSTCLSTWMRKKEEESEAEYQKRRRREFEKAKAKRRREEERWERELEEREREREEARWEREVTVTESRRIAAAPERGEGSEEDEGMRRIEAPPEEEEEGSERGMSRSGKGERAKSMSGKSEKAKSRSGQSERAKSRSGQSERAKSRSGKSERARSRAAQSERYSSEDEDERRYARRRPGRSRSRRAVDVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.38
5 0.43
6 0.5
7 0.53
8 0.6
9 0.7
10 0.77
11 0.8
12 0.84
13 0.85
14 0.86
15 0.84
16 0.82
17 0.8
18 0.78
19 0.77
20 0.76
21 0.7
22 0.63
23 0.61
24 0.58
25 0.59
26 0.6
27 0.61
28 0.61
29 0.64
30 0.68
31 0.68
32 0.68
33 0.65
34 0.64
35 0.59
36 0.52
37 0.5
38 0.43
39 0.39
40 0.36
41 0.33
42 0.28
43 0.24
44 0.22
45 0.2
46 0.21
47 0.27
48 0.25
49 0.23
50 0.19
51 0.19
52 0.18
53 0.16
54 0.16
55 0.08
56 0.08
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.08
68 0.1
69 0.14
70 0.2
71 0.27
72 0.29
73 0.31
74 0.34
75 0.38
76 0.43
77 0.43
78 0.43
79 0.42
80 0.44
81 0.48
82 0.49
83 0.49
84 0.48
85 0.53
86 0.5
87 0.52
88 0.52
89 0.59
90 0.65
91 0.7
92 0.76
93 0.77
94 0.84
95 0.86
96 0.86
97 0.82
98 0.79
99 0.78
100 0.74
101 0.76
102 0.76
103 0.75
104 0.73
105 0.67
106 0.61
107 0.54
108 0.54
109 0.45
110 0.42
111 0.35
112 0.33
113 0.32
114 0.32
115 0.3
116 0.26
117 0.3
118 0.3
119 0.31
120 0.32
121 0.31
122 0.31
123 0.31
124 0.29
125 0.26
126 0.26
127 0.25
128 0.23
129 0.22
130 0.22
131 0.21
132 0.19
133 0.17
134 0.14
135 0.17
136 0.16
137 0.17
138 0.18
139 0.17
140 0.18
141 0.17
142 0.16
143 0.12
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.07
151 0.07
152 0.1
153 0.1
154 0.12
155 0.13
156 0.16
157 0.18
158 0.17
159 0.17
160 0.16
161 0.16
162 0.14
163 0.12
164 0.1
165 0.09
166 0.12
167 0.12
168 0.11
169 0.17
170 0.19
171 0.26
172 0.3
173 0.34
174 0.35
175 0.39
176 0.41
177 0.38
178 0.39
179 0.4
180 0.4
181 0.41
182 0.41
183 0.45
184 0.49
185 0.5
186 0.53
187 0.48
188 0.52
189 0.57
190 0.59
191 0.6
192 0.61
193 0.67
194 0.67
195 0.68
196 0.62
197 0.54
198 0.56
199 0.56
200 0.53
201 0.52
202 0.55
203 0.6
204 0.64
205 0.66
206 0.65
207 0.59
208 0.6
209 0.6
210 0.58
211 0.58
212 0.61
213 0.67
214 0.7
215 0.72
216 0.71
217 0.65
218 0.66
219 0.65
220 0.62
221 0.61
222 0.56
223 0.58
224 0.55
225 0.55
226 0.51
227 0.42
228 0.41
229 0.39
230 0.38
231 0.36
232 0.37
233 0.35
234 0.39
235 0.43
236 0.46
237 0.5
238 0.57
239 0.61
240 0.69
241 0.78
242 0.82
243 0.88
244 0.92
245 0.92
246 0.9