Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225AL26

Protein Details
Accession A0A225AL26   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
158-184MEERQKTIERQERERRKKREDDQMIEDAcidic
NLS Segment(s)
PositionSequence
170-175RERRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 16
Family & Domain DBs
Amino Acid Sequences MPGVTGEPAGLTRQCSHSNDLSTLSPSSAPSGHKPFSFMRSSSFSFNKSHSHAEPPTIPECEKEPIFDEIRDCDEAPYPQTPQPRKSPTTGALDIKHKPEYKNFNNTANNNRSLSTSLPSVVPSNPPSSQSSTSPMPIPPHRNKWLNKLDPRFNAKLMEERQKTIERQERERRKKREDDQMIEDLLSKWAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.34
4 0.36
5 0.38
6 0.37
7 0.37
8 0.34
9 0.31
10 0.28
11 0.24
12 0.19
13 0.16
14 0.17
15 0.17
16 0.18
17 0.23
18 0.29
19 0.3
20 0.3
21 0.33
22 0.34
23 0.37
24 0.38
25 0.32
26 0.3
27 0.33
28 0.35
29 0.37
30 0.36
31 0.33
32 0.31
33 0.33
34 0.33
35 0.31
36 0.34
37 0.3
38 0.35
39 0.33
40 0.35
41 0.35
42 0.34
43 0.34
44 0.3
45 0.29
46 0.23
47 0.24
48 0.25
49 0.22
50 0.19
51 0.19
52 0.21
53 0.22
54 0.22
55 0.2
56 0.18
57 0.2
58 0.21
59 0.18
60 0.15
61 0.15
62 0.15
63 0.16
64 0.16
65 0.15
66 0.17
67 0.25
68 0.28
69 0.3
70 0.38
71 0.42
72 0.43
73 0.43
74 0.44
75 0.41
76 0.44
77 0.43
78 0.37
79 0.34
80 0.35
81 0.34
82 0.32
83 0.33
84 0.29
85 0.27
86 0.3
87 0.37
88 0.38
89 0.46
90 0.46
91 0.49
92 0.52
93 0.54
94 0.55
95 0.51
96 0.48
97 0.39
98 0.37
99 0.31
100 0.27
101 0.25
102 0.18
103 0.15
104 0.13
105 0.12
106 0.13
107 0.13
108 0.12
109 0.14
110 0.14
111 0.17
112 0.17
113 0.2
114 0.21
115 0.25
116 0.26
117 0.25
118 0.28
119 0.26
120 0.27
121 0.26
122 0.26
123 0.27
124 0.31
125 0.38
126 0.41
127 0.48
128 0.54
129 0.6
130 0.61
131 0.65
132 0.69
133 0.7
134 0.72
135 0.72
136 0.72
137 0.72
138 0.76
139 0.69
140 0.61
141 0.55
142 0.47
143 0.47
144 0.45
145 0.48
146 0.42
147 0.42
148 0.45
149 0.46
150 0.47
151 0.48
152 0.51
153 0.47
154 0.54
155 0.63
156 0.69
157 0.76
158 0.84
159 0.84
160 0.85
161 0.89
162 0.87
163 0.88
164 0.86
165 0.83
166 0.79
167 0.75
168 0.66
169 0.56
170 0.49
171 0.38