Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZWF8

Protein Details
Accession G8ZWF8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-120ERRILPKPSRRSRQTQKRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
97-114RILPKPSRRSRQTQKRPR
Subcellular Location(s) cyto_nucl 12.833, cyto 12, nucl 11.5, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tdl:TDEL_0F01410  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAPQAKILSQAPTELELQVAQAFSELENSSPELKAELRPLQFKSIREIDVASGKKALAIFVPVPSLAAYHKVQTKLTRELEKKFPDRHVVFLAERRILPKPSRRSRQTQKRPRSRTLTAVHDKVLEDLVFPTEIVGKRVRYLVGGNKVQKVLLDSKDVQQVDYKLESFQAVYNKLTGKQIVFEIPGETH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.17
4 0.13
5 0.13
6 0.12
7 0.11
8 0.08
9 0.08
10 0.08
11 0.07
12 0.1
13 0.1
14 0.09
15 0.1
16 0.13
17 0.14
18 0.14
19 0.14
20 0.13
21 0.14
22 0.16
23 0.2
24 0.25
25 0.26
26 0.31
27 0.33
28 0.39
29 0.42
30 0.4
31 0.41
32 0.39
33 0.37
34 0.33
35 0.32
36 0.25
37 0.29
38 0.29
39 0.23
40 0.2
41 0.18
42 0.19
43 0.18
44 0.16
45 0.09
46 0.11
47 0.1
48 0.1
49 0.11
50 0.09
51 0.1
52 0.09
53 0.09
54 0.07
55 0.1
56 0.1
57 0.12
58 0.16
59 0.18
60 0.2
61 0.24
62 0.29
63 0.32
64 0.36
65 0.41
66 0.41
67 0.44
68 0.49
69 0.51
70 0.52
71 0.48
72 0.47
73 0.47
74 0.45
75 0.43
76 0.38
77 0.34
78 0.29
79 0.3
80 0.29
81 0.21
82 0.21
83 0.2
84 0.2
85 0.2
86 0.23
87 0.28
88 0.36
89 0.44
90 0.53
91 0.56
92 0.63
93 0.71
94 0.78
95 0.81
96 0.82
97 0.83
98 0.85
99 0.87
100 0.86
101 0.82
102 0.74
103 0.71
104 0.66
105 0.65
106 0.6
107 0.54
108 0.47
109 0.41
110 0.38
111 0.3
112 0.26
113 0.16
114 0.1
115 0.09
116 0.09
117 0.08
118 0.08
119 0.07
120 0.1
121 0.11
122 0.13
123 0.16
124 0.15
125 0.17
126 0.18
127 0.18
128 0.15
129 0.19
130 0.24
131 0.3
132 0.36
133 0.38
134 0.39
135 0.39
136 0.38
137 0.35
138 0.31
139 0.28
140 0.24
141 0.27
142 0.25
143 0.28
144 0.35
145 0.35
146 0.31
147 0.3
148 0.29
149 0.27
150 0.28
151 0.25
152 0.19
153 0.2
154 0.2
155 0.16
156 0.19
157 0.2
158 0.2
159 0.2
160 0.23
161 0.25
162 0.26
163 0.29
164 0.28
165 0.23
166 0.23
167 0.24
168 0.24
169 0.24
170 0.23