Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZUX3

Protein Details
Accession G8ZUX3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPYLLKRRLRHVRSIRIDNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040939  Vps38  
Gene Ontology GO:0034272  C:phosphatidylinositol 3-kinase complex, class III, type II  
KEGG tdl:TDEL_0E01740  -  
Pfam View protein in Pfam  
PF17649  VPS38  
Amino Acid Sequences MPPYLLKRRLRHVRSIRIDNVSAPVDKNPGAQLRPFEASFIVLETLKGEPLYVSEVQSGFMHNIQFNELPHLEDPINHIVLKIAVKIPSRTELSSYVNENSWLALRVYEVDLNKLQSVNPNDLIDSYNAPLFEMTDGFYTLPGLPAARIVSDFSSHKRNVSNSRFVQSFSFNSALKVNKLIEYKTQVMIECSNSAAKVEEIILSNNRRDLWQIKCIARFKDELKRSMQEKTVNISILDGKIRPILKFNENEQADRQSLNDYYGNTYPNLIQTKDRVDFLRIKRLSKLIGVFKETCLFRKDFRFISVDEDTSSRSLYERTSLNLIDKKRIIKMASTNDAERELVNTCLGYYLIFIKLVATKVYDIPLPYSINYYGSTSLIGGDGALYLSDSAALKNPENFLEAMDKFNKNLIQIIQRWGHHRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.8
4 0.75
5 0.7
6 0.61
7 0.55
8 0.47
9 0.4
10 0.32
11 0.28
12 0.26
13 0.25
14 0.25
15 0.26
16 0.29
17 0.29
18 0.31
19 0.33
20 0.34
21 0.38
22 0.36
23 0.31
24 0.26
25 0.25
26 0.21
27 0.19
28 0.15
29 0.11
30 0.11
31 0.12
32 0.12
33 0.11
34 0.11
35 0.1
36 0.08
37 0.09
38 0.14
39 0.13
40 0.14
41 0.16
42 0.16
43 0.18
44 0.18
45 0.18
46 0.15
47 0.16
48 0.17
49 0.15
50 0.16
51 0.18
52 0.2
53 0.19
54 0.23
55 0.22
56 0.22
57 0.21
58 0.23
59 0.2
60 0.19
61 0.23
62 0.22
63 0.23
64 0.2
65 0.2
66 0.17
67 0.19
68 0.2
69 0.17
70 0.15
71 0.18
72 0.21
73 0.23
74 0.24
75 0.27
76 0.29
77 0.27
78 0.28
79 0.27
80 0.29
81 0.31
82 0.31
83 0.28
84 0.26
85 0.26
86 0.23
87 0.19
88 0.16
89 0.14
90 0.11
91 0.09
92 0.09
93 0.1
94 0.12
95 0.15
96 0.14
97 0.16
98 0.17
99 0.19
100 0.19
101 0.18
102 0.17
103 0.2
104 0.23
105 0.24
106 0.25
107 0.23
108 0.23
109 0.23
110 0.24
111 0.18
112 0.16
113 0.13
114 0.12
115 0.11
116 0.11
117 0.1
118 0.09
119 0.09
120 0.07
121 0.07
122 0.07
123 0.08
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.08
133 0.08
134 0.07
135 0.07
136 0.08
137 0.08
138 0.1
139 0.12
140 0.13
141 0.2
142 0.2
143 0.22
144 0.24
145 0.29
146 0.36
147 0.41
148 0.48
149 0.43
150 0.46
151 0.45
152 0.42
153 0.4
154 0.33
155 0.27
156 0.22
157 0.22
158 0.18
159 0.19
160 0.21
161 0.2
162 0.18
163 0.19
164 0.16
165 0.18
166 0.19
167 0.19
168 0.19
169 0.23
170 0.24
171 0.23
172 0.24
173 0.2
174 0.2
175 0.2
176 0.18
177 0.14
178 0.12
179 0.11
180 0.09
181 0.09
182 0.08
183 0.07
184 0.06
185 0.06
186 0.07
187 0.07
188 0.08
189 0.12
190 0.13
191 0.13
192 0.14
193 0.14
194 0.13
195 0.15
196 0.18
197 0.18
198 0.22
199 0.27
200 0.29
201 0.34
202 0.38
203 0.37
204 0.35
205 0.34
206 0.31
207 0.35
208 0.37
209 0.34
210 0.34
211 0.37
212 0.37
213 0.38
214 0.38
215 0.34
216 0.31
217 0.32
218 0.3
219 0.26
220 0.24
221 0.22
222 0.19
223 0.15
224 0.15
225 0.11
226 0.09
227 0.13
228 0.14
229 0.13
230 0.16
231 0.19
232 0.23
233 0.25
234 0.27
235 0.33
236 0.32
237 0.34
238 0.32
239 0.31
240 0.27
241 0.24
242 0.22
243 0.15
244 0.15
245 0.16
246 0.16
247 0.13
248 0.16
249 0.17
250 0.18
251 0.16
252 0.16
253 0.14
254 0.18
255 0.19
256 0.17
257 0.17
258 0.19
259 0.24
260 0.25
261 0.26
262 0.22
263 0.24
264 0.32
265 0.34
266 0.41
267 0.38
268 0.38
269 0.39
270 0.41
271 0.38
272 0.34
273 0.36
274 0.32
275 0.33
276 0.36
277 0.34
278 0.33
279 0.37
280 0.33
281 0.3
282 0.27
283 0.26
284 0.25
285 0.3
286 0.34
287 0.3
288 0.33
289 0.33
290 0.29
291 0.34
292 0.33
293 0.27
294 0.23
295 0.22
296 0.21
297 0.19
298 0.18
299 0.12
300 0.1
301 0.11
302 0.1
303 0.14
304 0.13
305 0.15
306 0.18
307 0.19
308 0.24
309 0.29
310 0.29
311 0.32
312 0.35
313 0.36
314 0.36
315 0.4
316 0.35
317 0.35
318 0.42
319 0.43
320 0.46
321 0.46
322 0.44
323 0.4
324 0.41
325 0.36
326 0.27
327 0.21
328 0.16
329 0.14
330 0.13
331 0.11
332 0.1
333 0.1
334 0.1
335 0.08
336 0.07
337 0.09
338 0.09
339 0.09
340 0.09
341 0.1
342 0.13
343 0.14
344 0.14
345 0.13
346 0.14
347 0.15
348 0.17
349 0.17
350 0.15
351 0.17
352 0.2
353 0.2
354 0.19
355 0.21
356 0.2
357 0.2
358 0.2
359 0.2
360 0.18
361 0.16
362 0.16
363 0.13
364 0.13
365 0.11
366 0.09
367 0.07
368 0.06
369 0.06
370 0.05
371 0.05
372 0.04
373 0.04
374 0.04
375 0.06
376 0.06
377 0.07
378 0.12
379 0.15
380 0.17
381 0.2
382 0.22
383 0.22
384 0.24
385 0.23
386 0.21
387 0.25
388 0.24
389 0.26
390 0.31
391 0.31
392 0.29
393 0.34
394 0.34
395 0.28
396 0.31
397 0.31
398 0.33
399 0.35
400 0.42
401 0.44
402 0.45
403 0.49