Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225ATH4

Protein Details
Accession A0A225ATH4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-94AERRRIQNRIAQRNYRKKLKRRLEELERRGASHydrophilic
NLS Segment(s)
PositionSequence
73-85AQRNYRKKLKRRL
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MATMNQHLPYGYPYPTTTATTSNTLTVSMATATPSYTTHHGTSSAFSDNANPNEDWTKISDLAERRRIQNRIAQRNYRKKLKRRLEELERRGASESASPEQPHAEIERTKQQTNKKSQSSRSANNNTQSRKARSSRSSWSSSQDHLSLPQQQQHSTYNSMSEERAGGSGGEFFYSPYPSAYGQLNAYPSAQPPFQNHHQPHHLDAYQTSPQPHYGELPSQHLSDDSALNPLCISYASITGLEVPAPHFPHYNTQLQSPPLTNPYSDGYSTSSPAGSLEQYPLTPEPTRLTPERVEFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.28
4 0.25
5 0.25
6 0.27
7 0.28
8 0.29
9 0.26
10 0.24
11 0.21
12 0.2
13 0.16
14 0.14
15 0.11
16 0.1
17 0.09
18 0.09
19 0.09
20 0.1
21 0.1
22 0.13
23 0.15
24 0.19
25 0.19
26 0.2
27 0.21
28 0.21
29 0.22
30 0.22
31 0.22
32 0.18
33 0.17
34 0.22
35 0.26
36 0.28
37 0.29
38 0.26
39 0.25
40 0.28
41 0.28
42 0.23
43 0.2
44 0.22
45 0.2
46 0.21
47 0.24
48 0.28
49 0.36
50 0.43
51 0.43
52 0.46
53 0.52
54 0.53
55 0.51
56 0.52
57 0.54
58 0.56
59 0.61
60 0.65
61 0.68
62 0.77
63 0.81
64 0.84
65 0.83
66 0.82
67 0.85
68 0.86
69 0.85
70 0.82
71 0.84
72 0.85
73 0.86
74 0.82
75 0.81
76 0.71
77 0.62
78 0.55
79 0.46
80 0.35
81 0.28
82 0.26
83 0.18
84 0.2
85 0.19
86 0.18
87 0.19
88 0.18
89 0.16
90 0.14
91 0.15
92 0.14
93 0.17
94 0.26
95 0.29
96 0.31
97 0.35
98 0.41
99 0.47
100 0.55
101 0.6
102 0.6
103 0.63
104 0.66
105 0.71
106 0.7
107 0.68
108 0.68
109 0.67
110 0.63
111 0.64
112 0.65
113 0.57
114 0.57
115 0.57
116 0.51
117 0.5
118 0.5
119 0.5
120 0.48
121 0.51
122 0.51
123 0.51
124 0.51
125 0.46
126 0.47
127 0.42
128 0.4
129 0.36
130 0.29
131 0.24
132 0.2
133 0.21
134 0.21
135 0.2
136 0.22
137 0.21
138 0.21
139 0.23
140 0.24
141 0.25
142 0.21
143 0.2
144 0.18
145 0.18
146 0.18
147 0.16
148 0.13
149 0.11
150 0.09
151 0.09
152 0.07
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.05
159 0.06
160 0.06
161 0.07
162 0.08
163 0.07
164 0.08
165 0.08
166 0.1
167 0.11
168 0.11
169 0.11
170 0.12
171 0.13
172 0.12
173 0.13
174 0.12
175 0.12
176 0.13
177 0.13
178 0.14
179 0.16
180 0.22
181 0.27
182 0.36
183 0.37
184 0.41
185 0.46
186 0.46
187 0.46
188 0.45
189 0.4
190 0.31
191 0.3
192 0.29
193 0.27
194 0.27
195 0.25
196 0.2
197 0.22
198 0.22
199 0.22
200 0.2
201 0.18
202 0.21
203 0.21
204 0.26
205 0.25
206 0.24
207 0.24
208 0.21
209 0.2
210 0.17
211 0.16
212 0.11
213 0.14
214 0.14
215 0.13
216 0.13
217 0.12
218 0.1
219 0.09
220 0.1
221 0.06
222 0.08
223 0.09
224 0.09
225 0.09
226 0.1
227 0.1
228 0.09
229 0.08
230 0.08
231 0.12
232 0.14
233 0.16
234 0.17
235 0.18
236 0.26
237 0.31
238 0.37
239 0.34
240 0.35
241 0.38
242 0.39
243 0.41
244 0.34
245 0.32
246 0.29
247 0.29
248 0.26
249 0.24
250 0.26
251 0.26
252 0.24
253 0.23
254 0.23
255 0.23
256 0.25
257 0.23
258 0.19
259 0.16
260 0.16
261 0.17
262 0.14
263 0.14
264 0.15
265 0.16
266 0.16
267 0.19
268 0.2
269 0.22
270 0.22
271 0.23
272 0.25
273 0.27
274 0.33
275 0.33
276 0.37
277 0.38