Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZP55

Protein Details
Accession G8ZP55   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-47TSNSSRVSKRTSKKRKNGCYVDKCGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG tdl:TDEL_0B02700  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSSEELKLEGKQEDVIKSVSSTSNSSRVSKRTSKKRKNGCYVDKCGSAASKFIGDCNFCKGHYCSKHRLMENHSCEGLTSCKEAMHKRNADKLEKEQTRAPKIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.19
5 0.2
6 0.18
7 0.17
8 0.18
9 0.19
10 0.26
11 0.28
12 0.32
13 0.33
14 0.35
15 0.4
16 0.46
17 0.53
18 0.57
19 0.66
20 0.72
21 0.78
22 0.85
23 0.88
24 0.89
25 0.89
26 0.89
27 0.86
28 0.82
29 0.76
30 0.66
31 0.57
32 0.47
33 0.38
34 0.27
35 0.2
36 0.13
37 0.11
38 0.1
39 0.1
40 0.11
41 0.11
42 0.12
43 0.16
44 0.16
45 0.14
46 0.18
47 0.19
48 0.26
49 0.33
50 0.39
51 0.41
52 0.49
53 0.56
54 0.56
55 0.59
56 0.57
57 0.59
58 0.58
59 0.54
60 0.46
61 0.39
62 0.36
63 0.32
64 0.28
65 0.19
66 0.16
67 0.13
68 0.15
69 0.19
70 0.25
71 0.31
72 0.39
73 0.45
74 0.48
75 0.55
76 0.6
77 0.63
78 0.62
79 0.63
80 0.64
81 0.6
82 0.59
83 0.58
84 0.61
85 0.62