Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225AQX5

Protein Details
Accession A0A225AQX5    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
161-180RPFSRFTRPTKVRRHGVDGRBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 11.5, nucl 8, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000868  Isochorismatase-like  
IPR036380  Isochorismatase-like_sf  
Pfam View protein in Pfam  
PF00857  Isochorismatase  
CDD cd00431  cysteine_hydrolases  
Amino Acid Sequences MVQLDSAPALVVVDMQNGFCHEQGSFAKIGAQSEPTAIVPRINELRSAFRAANIPVFFLRTGYNADYSDRRGRDARDRVEQLQGLIRGSWDADILDELTPQPGETVVNKTRNSGFFRTSLEDTLKERGVNHLIITGVGTDVCVESTARDAYQLDFAVTTARPFSRFTRPTKVRRHGVDGRSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.14
6 0.12
7 0.13
8 0.1
9 0.14
10 0.15
11 0.18
12 0.16
13 0.15
14 0.18
15 0.18
16 0.2
17 0.16
18 0.17
19 0.14
20 0.14
21 0.16
22 0.13
23 0.15
24 0.14
25 0.14
26 0.12
27 0.16
28 0.2
29 0.19
30 0.22
31 0.21
32 0.25
33 0.26
34 0.3
35 0.26
36 0.23
37 0.25
38 0.23
39 0.27
40 0.22
41 0.21
42 0.17
43 0.19
44 0.17
45 0.15
46 0.15
47 0.1
48 0.13
49 0.12
50 0.14
51 0.13
52 0.15
53 0.16
54 0.2
55 0.25
56 0.23
57 0.25
58 0.25
59 0.28
60 0.35
61 0.42
62 0.41
63 0.42
64 0.45
65 0.44
66 0.45
67 0.42
68 0.33
69 0.28
70 0.25
71 0.17
72 0.14
73 0.12
74 0.09
75 0.09
76 0.08
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.06
92 0.13
93 0.18
94 0.24
95 0.24
96 0.26
97 0.29
98 0.33
99 0.36
100 0.33
101 0.3
102 0.26
103 0.28
104 0.31
105 0.29
106 0.27
107 0.24
108 0.23
109 0.23
110 0.25
111 0.23
112 0.19
113 0.18
114 0.2
115 0.21
116 0.2
117 0.18
118 0.16
119 0.14
120 0.14
121 0.13
122 0.1
123 0.07
124 0.06
125 0.06
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.05
132 0.08
133 0.09
134 0.09
135 0.1
136 0.11
137 0.12
138 0.15
139 0.15
140 0.13
141 0.12
142 0.12
143 0.13
144 0.13
145 0.12
146 0.12
147 0.13
148 0.14
149 0.17
150 0.22
151 0.3
152 0.36
153 0.42
154 0.5
155 0.58
156 0.66
157 0.74
158 0.79
159 0.78
160 0.78
161 0.8
162 0.78