Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9A043

Protein Details
Accession G9A043    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
266-291GEEDEGKKKKRKITSAKRRPKIEIEYBasic
NLS Segment(s)
PositionSequence
141-151VKRREENRERK
271-286GKKKKRKITSAKRRPK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG tdl:TDEL_0H03780  -  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSDDIVWQLINNQFCSYKLTTDKGQTFCRNEYNVTGLCSRQACPLANSKYATVKSVNGRLYIYMKTAERAHTPAKMWERIKLSKNYSKALQQIDDHLLYWNKFLIHKCKQRLTKLTQVAITERRMALREEERHYVGVAPKVKRREENRERKALIAAKIEKSIEKELLDRLKSGAYGDKPLNVDEKIWKKVMGHMEDENEAQEDEENWEEEEEEESDEGEVEYVEDEGDDDLVDLEDLENWLDGSNSDRDASEEESDDESDEDSDSGEEDEGKKKKRKITSAKRRPKIEIEYEEEQAQPAAQEIAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.26
4 0.28
5 0.3
6 0.33
7 0.36
8 0.44
9 0.51
10 0.5
11 0.56
12 0.58
13 0.58
14 0.58
15 0.59
16 0.53
17 0.48
18 0.46
19 0.43
20 0.36
21 0.34
22 0.32
23 0.25
24 0.27
25 0.27
26 0.25
27 0.25
28 0.27
29 0.26
30 0.27
31 0.36
32 0.36
33 0.39
34 0.4
35 0.37
36 0.39
37 0.38
38 0.38
39 0.31
40 0.31
41 0.32
42 0.38
43 0.38
44 0.32
45 0.32
46 0.32
47 0.32
48 0.28
49 0.24
50 0.21
51 0.19
52 0.21
53 0.22
54 0.23
55 0.23
56 0.26
57 0.27
58 0.27
59 0.28
60 0.33
61 0.36
62 0.42
63 0.4
64 0.41
65 0.45
66 0.48
67 0.53
68 0.53
69 0.55
70 0.54
71 0.57
72 0.54
73 0.5
74 0.48
75 0.48
76 0.44
77 0.39
78 0.33
79 0.33
80 0.33
81 0.31
82 0.26
83 0.23
84 0.22
85 0.19
86 0.18
87 0.16
88 0.13
89 0.16
90 0.19
91 0.25
92 0.33
93 0.41
94 0.46
95 0.53
96 0.59
97 0.64
98 0.68
99 0.66
100 0.66
101 0.63
102 0.6
103 0.54
104 0.48
105 0.44
106 0.4
107 0.34
108 0.27
109 0.22
110 0.2
111 0.19
112 0.19
113 0.19
114 0.22
115 0.26
116 0.28
117 0.3
118 0.3
119 0.29
120 0.29
121 0.27
122 0.22
123 0.22
124 0.24
125 0.24
126 0.27
127 0.32
128 0.34
129 0.39
130 0.42
131 0.48
132 0.53
133 0.62
134 0.64
135 0.67
136 0.66
137 0.6
138 0.58
139 0.51
140 0.43
141 0.38
142 0.34
143 0.28
144 0.28
145 0.28
146 0.24
147 0.23
148 0.21
149 0.17
150 0.14
151 0.14
152 0.17
153 0.21
154 0.21
155 0.19
156 0.17
157 0.16
158 0.16
159 0.15
160 0.16
161 0.12
162 0.15
163 0.15
164 0.18
165 0.18
166 0.19
167 0.2
168 0.16
169 0.16
170 0.2
171 0.25
172 0.25
173 0.25
174 0.25
175 0.23
176 0.29
177 0.34
178 0.3
179 0.28
180 0.27
181 0.28
182 0.28
183 0.28
184 0.22
185 0.16
186 0.13
187 0.1
188 0.08
189 0.07
190 0.08
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.09
197 0.09
198 0.08
199 0.08
200 0.07
201 0.07
202 0.07
203 0.07
204 0.06
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.08
231 0.1
232 0.11
233 0.11
234 0.11
235 0.12
236 0.15
237 0.18
238 0.17
239 0.16
240 0.17
241 0.18
242 0.18
243 0.18
244 0.16
245 0.13
246 0.12
247 0.11
248 0.09
249 0.07
250 0.07
251 0.07
252 0.07
253 0.07
254 0.08
255 0.1
256 0.19
257 0.25
258 0.33
259 0.41
260 0.46
261 0.55
262 0.63
263 0.71
264 0.75
265 0.8
266 0.83
267 0.87
268 0.91
269 0.92
270 0.89
271 0.85
272 0.82
273 0.79
274 0.78
275 0.74
276 0.7
277 0.65
278 0.61
279 0.56
280 0.47
281 0.39
282 0.29
283 0.22
284 0.14
285 0.11