Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZW43

Protein Details
Accession G8ZW43   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GEFRGNRQRREPSRPAKKRVKFENIPLDVHydrophilic
NLS Segment(s)
PositionSequence
11-24RQRREPSRPAKKRV
106-106R
118-127AVGKKRGKAK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
KEGG tdl:TDEL_0F00260  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MNIGGEFRGNRQRREPSRPAKKRVKFENIPLDVSDYTLEDMVQEFGTPVYSNFYDTKESRTAVFEFEDSSVLQKIVEKYNDTELNGGKLKVEIYDSNGSQDRRHRRGDNRGSGGSHYAVGKKRGKAKEQVKPTTVQDLNAELEEYMNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.73
4 0.8
5 0.85
6 0.87
7 0.87
8 0.87
9 0.87
10 0.86
11 0.85
12 0.8
13 0.79
14 0.8
15 0.72
16 0.66
17 0.56
18 0.5
19 0.4
20 0.34
21 0.25
22 0.15
23 0.13
24 0.11
25 0.1
26 0.06
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.09
37 0.09
38 0.11
39 0.12
40 0.14
41 0.18
42 0.19
43 0.23
44 0.22
45 0.22
46 0.21
47 0.22
48 0.21
49 0.18
50 0.18
51 0.13
52 0.12
53 0.12
54 0.12
55 0.09
56 0.09
57 0.08
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.13
64 0.14
65 0.14
66 0.2
67 0.21
68 0.2
69 0.2
70 0.17
71 0.19
72 0.19
73 0.17
74 0.12
75 0.11
76 0.11
77 0.1
78 0.12
79 0.09
80 0.13
81 0.16
82 0.16
83 0.19
84 0.23
85 0.23
86 0.24
87 0.32
88 0.36
89 0.38
90 0.45
91 0.49
92 0.54
93 0.64
94 0.71
95 0.73
96 0.69
97 0.66
98 0.61
99 0.55
100 0.49
101 0.39
102 0.3
103 0.22
104 0.22
105 0.23
106 0.29
107 0.34
108 0.37
109 0.46
110 0.51
111 0.56
112 0.61
113 0.67
114 0.69
115 0.73
116 0.76
117 0.69
118 0.66
119 0.63
120 0.63
121 0.54
122 0.46
123 0.38
124 0.33
125 0.32
126 0.28
127 0.26
128 0.16