Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZPR8

Protein Details
Accession G8ZPR8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-21NESKRTQQDTQQPQQQRRKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017132  Lsm7  
IPR044641  Lsm7/SmG-like  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:0032991  C:protein-containing complex  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
KEGG tdl:TDEL_0B04830  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01729  LSm7  
Amino Acid Sequences MNESKRTQQDTQQPQQQRRKFEGPKREAILDLAKYKDSKVRVKLMGGRLVTGILKGYDQLMNLVLDETLEYMRDPEDPSVILKDKTRELGLIVIRGTVLLSLSPCDGSEVIYVQEAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.78
4 0.75
5 0.73
6 0.74
7 0.75
8 0.75
9 0.76
10 0.72
11 0.75
12 0.71
13 0.65
14 0.55
15 0.48
16 0.44
17 0.37
18 0.33
19 0.27
20 0.25
21 0.23
22 0.24
23 0.26
24 0.26
25 0.29
26 0.31
27 0.37
28 0.37
29 0.4
30 0.45
31 0.45
32 0.45
33 0.38
34 0.33
35 0.26
36 0.25
37 0.21
38 0.15
39 0.11
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.1
66 0.13
67 0.15
68 0.15
69 0.17
70 0.19
71 0.2
72 0.23
73 0.22
74 0.19
75 0.18
76 0.22
77 0.21
78 0.21
79 0.18
80 0.16
81 0.15
82 0.14
83 0.13
84 0.08
85 0.07
86 0.05
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.11
93 0.1
94 0.11
95 0.12
96 0.12
97 0.12