Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZLM7

Protein Details
Accession G8ZLM7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-106EPEKETGEKRKKLRSNQDLRLSDRBasic
NLS Segment(s)
PositionSequence
93-93K
Subcellular Location(s) plas 13, E.R. 6, mito 4, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013945  Pkr1  
Gene Ontology GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG tdl:TDEL_0A01890  -  
Pfam View protein in Pfam  
PF08636  Pkr1  
Amino Acid Sequences MANFFVALWESIFQPGTTPQLIIATHVSFFALLCTLAWLIYATSGNIHFYALFAIASCLWIAVIWFIQELNSANLMDNKQLEEPEKETGEKRKKLRSNQDLRLSDRGKFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.15
4 0.14
5 0.14
6 0.12
7 0.15
8 0.15
9 0.15
10 0.16
11 0.13
12 0.13
13 0.13
14 0.12
15 0.09
16 0.09
17 0.08
18 0.06
19 0.05
20 0.05
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.06
57 0.07
58 0.08
59 0.08
60 0.08
61 0.11
62 0.12
63 0.13
64 0.12
65 0.12
66 0.12
67 0.14
68 0.16
69 0.16
70 0.18
71 0.21
72 0.22
73 0.22
74 0.25
75 0.34
76 0.42
77 0.46
78 0.5
79 0.57
80 0.64
81 0.72
82 0.8
83 0.8
84 0.81
85 0.83
86 0.87
87 0.82
88 0.79
89 0.79
90 0.69