Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225ASZ5

Protein Details
Accession A0A225ASZ5   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-102APIDIKAKVKRKNMRRIVNKNRSWPRNPNFHydrophilic
NLS Segment(s)
PositionSequence
78-93KAKVKRKNMRRIVNKN
Subcellular Location(s) cyto_nucl 11.333, nucl 11, cyto 10.5, mito_nucl 7.333, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015366  S53_propep  
Gene Ontology GO:0008236  F:serine-type peptidase activity  
Pfam View protein in Pfam  
PF09286  Pro-kuma_activ  
Amino Acid Sequences MVISSESITNSDNRGWLAFYATTDEAEYLLKTEFQGFEDSLTGCIMPACDEYHVPHQIKEHNDFIAPGIKLLAPIDIKAKVKRKNMRRIVNKNRSWPRNPNFPKMLEYYLSLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.16
5 0.14
6 0.13
7 0.16
8 0.16
9 0.16
10 0.15
11 0.15
12 0.12
13 0.12
14 0.11
15 0.08
16 0.08
17 0.07
18 0.07
19 0.09
20 0.09
21 0.1
22 0.12
23 0.11
24 0.11
25 0.12
26 0.12
27 0.11
28 0.1
29 0.09
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.07
38 0.09
39 0.14
40 0.2
41 0.19
42 0.19
43 0.21
44 0.24
45 0.27
46 0.29
47 0.26
48 0.21
49 0.2
50 0.19
51 0.18
52 0.19
53 0.16
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.12
60 0.07
61 0.08
62 0.11
63 0.14
64 0.17
65 0.23
66 0.31
67 0.36
68 0.46
69 0.55
70 0.62
71 0.69
72 0.77
73 0.81
74 0.84
75 0.87
76 0.89
77 0.91
78 0.87
79 0.87
80 0.87
81 0.85
82 0.81
83 0.81
84 0.76
85 0.77
86 0.77
87 0.76
88 0.71
89 0.65
90 0.62
91 0.56
92 0.54
93 0.44