Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A225AHM9

Protein Details
Accession A0A225AHM9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
524-543EKAEERKRQGKSFARQRGNTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 7, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002129  PyrdxlP-dep_de-COase  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0016830  F:carbon-carbon lyase activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019752  P:carboxylic acid metabolic process  
Pfam View protein in Pfam  
PF00282  Pyridoxal_deC  
Amino Acid Sequences MASSLIPASMQARIMAGSPRNLSGAVAMLNLDLLKNVVFLFFVLRYTRKTFDSLRGYGIIGSIKRVYAAIKLWAFYLFLRAPGVRGQVDKQVTTALTKLEEKMVRKGPGITSYLALPKEGWTSEQIRTELAQLVGMEHAKWEEGRVSGAVYHGGEDLSKLQTEAIGTFSVSNPLHPDVFPGVRKMEAEVVAMVLSLFHGPSDGAGVTTSGGTESILMACLAARQKAYAERGVTEPEMVVPETVHAAFFKAGSYFGIKVHRVPCPAPEYKVHIPSVRRLINRNTVLIAGSAPNFPHGIVDNIPALSRLAVSYKIPLHVDCCLGSFIIAFLKKAGFPSPYEEEGGFDFRQPGVTSISVDTHKYGFAPKGNSVLIYRNRSYRNHQYFIFPDWIGGVYASPSIAGSRSGALIAGCWVSLMTIGEAGYIASCHQIMGAAKQFETAIREDPILSANIEVIGNPEVSVVAFASKNIGIDTYDIADAMSEKGWHLNALQDPPAIHVAFTRPTALAVEKLQLELTEVITAELEKAEERKRQGKSFARQRGNTSALYGVAGSLPDKSIVNRLAEGFLDALYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.2
4 0.23
5 0.25
6 0.25
7 0.26
8 0.26
9 0.24
10 0.19
11 0.17
12 0.13
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.1
28 0.1
29 0.12
30 0.15
31 0.18
32 0.22
33 0.27
34 0.3
35 0.29
36 0.34
37 0.36
38 0.42
39 0.48
40 0.45
41 0.44
42 0.42
43 0.4
44 0.35
45 0.32
46 0.27
47 0.19
48 0.21
49 0.18
50 0.17
51 0.17
52 0.17
53 0.16
54 0.15
55 0.17
56 0.22
57 0.22
58 0.22
59 0.23
60 0.23
61 0.22
62 0.19
63 0.23
64 0.16
65 0.15
66 0.18
67 0.17
68 0.18
69 0.2
70 0.24
71 0.2
72 0.22
73 0.23
74 0.28
75 0.31
76 0.29
77 0.26
78 0.25
79 0.24
80 0.23
81 0.22
82 0.16
83 0.16
84 0.17
85 0.18
86 0.23
87 0.27
88 0.28
89 0.34
90 0.4
91 0.4
92 0.4
93 0.42
94 0.38
95 0.38
96 0.38
97 0.31
98 0.25
99 0.25
100 0.28
101 0.24
102 0.22
103 0.17
104 0.16
105 0.18
106 0.17
107 0.16
108 0.16
109 0.2
110 0.23
111 0.28
112 0.27
113 0.25
114 0.25
115 0.26
116 0.24
117 0.2
118 0.18
119 0.13
120 0.13
121 0.14
122 0.13
123 0.11
124 0.08
125 0.09
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.1
132 0.1
133 0.1
134 0.1
135 0.11
136 0.11
137 0.09
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.1
144 0.09
145 0.09
146 0.08
147 0.08
148 0.09
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.14
157 0.13
158 0.13
159 0.14
160 0.16
161 0.17
162 0.16
163 0.18
164 0.16
165 0.2
166 0.2
167 0.2
168 0.19
169 0.19
170 0.19
171 0.18
172 0.17
173 0.15
174 0.14
175 0.12
176 0.11
177 0.1
178 0.1
179 0.08
180 0.05
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.06
207 0.07
208 0.08
209 0.08
210 0.08
211 0.09
212 0.13
213 0.16
214 0.17
215 0.17
216 0.18
217 0.19
218 0.21
219 0.2
220 0.16
221 0.13
222 0.1
223 0.1
224 0.09
225 0.08
226 0.05
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.06
233 0.06
234 0.06
235 0.06
236 0.05
237 0.06
238 0.06
239 0.08
240 0.08
241 0.1
242 0.14
243 0.14
244 0.18
245 0.21
246 0.23
247 0.23
248 0.23
249 0.25
250 0.27
251 0.28
252 0.26
253 0.25
254 0.3
255 0.32
256 0.35
257 0.33
258 0.31
259 0.3
260 0.32
261 0.38
262 0.36
263 0.33
264 0.33
265 0.36
266 0.41
267 0.41
268 0.37
269 0.3
270 0.25
271 0.24
272 0.2
273 0.16
274 0.08
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.07
282 0.07
283 0.07
284 0.08
285 0.09
286 0.09
287 0.09
288 0.09
289 0.08
290 0.08
291 0.06
292 0.06
293 0.05
294 0.05
295 0.06
296 0.07
297 0.1
298 0.1
299 0.12
300 0.13
301 0.12
302 0.13
303 0.13
304 0.14
305 0.11
306 0.11
307 0.1
308 0.09
309 0.09
310 0.07
311 0.06
312 0.08
313 0.08
314 0.07
315 0.08
316 0.08
317 0.09
318 0.1
319 0.12
320 0.1
321 0.11
322 0.16
323 0.19
324 0.2
325 0.21
326 0.2
327 0.19
328 0.19
329 0.21
330 0.16
331 0.13
332 0.12
333 0.11
334 0.12
335 0.12
336 0.12
337 0.11
338 0.11
339 0.12
340 0.12
341 0.14
342 0.14
343 0.14
344 0.14
345 0.12
346 0.12
347 0.11
348 0.13
349 0.13
350 0.16
351 0.19
352 0.19
353 0.21
354 0.21
355 0.22
356 0.21
357 0.25
358 0.28
359 0.3
360 0.31
361 0.34
362 0.38
363 0.4
364 0.47
365 0.51
366 0.52
367 0.5
368 0.49
369 0.48
370 0.46
371 0.47
372 0.43
373 0.31
374 0.24
375 0.2
376 0.2
377 0.15
378 0.13
379 0.09
380 0.05
381 0.06
382 0.05
383 0.05
384 0.04
385 0.05
386 0.05
387 0.06
388 0.06
389 0.06
390 0.07
391 0.07
392 0.07
393 0.07
394 0.06
395 0.07
396 0.06
397 0.05
398 0.05
399 0.05
400 0.04
401 0.05
402 0.05
403 0.04
404 0.05
405 0.05
406 0.05
407 0.05
408 0.05
409 0.05
410 0.04
411 0.04
412 0.05
413 0.05
414 0.05
415 0.05
416 0.07
417 0.08
418 0.12
419 0.18
420 0.18
421 0.18
422 0.19
423 0.19
424 0.18
425 0.2
426 0.17
427 0.14
428 0.15
429 0.15
430 0.15
431 0.15
432 0.16
433 0.14
434 0.12
435 0.1
436 0.08
437 0.09
438 0.09
439 0.08
440 0.08
441 0.08
442 0.08
443 0.08
444 0.08
445 0.07
446 0.07
447 0.07
448 0.06
449 0.07
450 0.07
451 0.07
452 0.09
453 0.1
454 0.1
455 0.1
456 0.1
457 0.09
458 0.1
459 0.11
460 0.1
461 0.1
462 0.1
463 0.09
464 0.09
465 0.09
466 0.09
467 0.08
468 0.07
469 0.07
470 0.1
471 0.1
472 0.11
473 0.11
474 0.15
475 0.18
476 0.21
477 0.23
478 0.22
479 0.22
480 0.24
481 0.27
482 0.22
483 0.18
484 0.16
485 0.18
486 0.19
487 0.2
488 0.19
489 0.15
490 0.16
491 0.18
492 0.18
493 0.18
494 0.17
495 0.19
496 0.18
497 0.18
498 0.18
499 0.16
500 0.17
501 0.15
502 0.14
503 0.12
504 0.11
505 0.11
506 0.11
507 0.11
508 0.09
509 0.08
510 0.08
511 0.08
512 0.13
513 0.19
514 0.24
515 0.31
516 0.39
517 0.45
518 0.51
519 0.59
520 0.64
521 0.69
522 0.74
523 0.78
524 0.8
525 0.78
526 0.78
527 0.77
528 0.71
529 0.61
530 0.52
531 0.43
532 0.34
533 0.3
534 0.24
535 0.15
536 0.12
537 0.12
538 0.09
539 0.09
540 0.09
541 0.1
542 0.11
543 0.12
544 0.18
545 0.22
546 0.24
547 0.26
548 0.26
549 0.27
550 0.26
551 0.26
552 0.2
553 0.16