Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZU39

Protein Details
Accession G8ZU39   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-41SPTAEVIKQRKKPRVEKKSKLSLDQHydrophilic
NLS Segment(s)
PositionSequence
25-36QRKKPRVEKKSK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
KEGG tdl:TDEL_0D05490  -  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MTIANSPGVNGVNPVISPTAEVIKQRKKPRVEKKSKLSLDQVRKNHVVSEQRRRELVRGIYDDLVGIVPGLEKSERRSEFLIYVKTMNHLSWLYKRNSYLRAKLYEKYESQGRSNVAIPNWLVWDLPQSLAHDNQKPSPSPSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.1
5 0.1
6 0.13
7 0.14
8 0.19
9 0.26
10 0.34
11 0.43
12 0.51
13 0.58
14 0.64
15 0.73
16 0.8
17 0.83
18 0.85
19 0.86
20 0.87
21 0.89
22 0.84
23 0.78
24 0.75
25 0.73
26 0.72
27 0.71
28 0.65
29 0.6
30 0.59
31 0.55
32 0.48
33 0.43
34 0.43
35 0.41
36 0.49
37 0.5
38 0.5
39 0.52
40 0.51
41 0.48
42 0.45
43 0.42
44 0.36
45 0.31
46 0.31
47 0.29
48 0.28
49 0.26
50 0.19
51 0.15
52 0.09
53 0.05
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.08
61 0.16
62 0.17
63 0.19
64 0.2
65 0.21
66 0.24
67 0.27
68 0.26
69 0.19
70 0.2
71 0.18
72 0.18
73 0.18
74 0.14
75 0.13
76 0.12
77 0.13
78 0.19
79 0.25
80 0.26
81 0.27
82 0.3
83 0.32
84 0.39
85 0.43
86 0.43
87 0.43
88 0.47
89 0.48
90 0.49
91 0.49
92 0.47
93 0.43
94 0.39
95 0.4
96 0.36
97 0.35
98 0.35
99 0.33
100 0.29
101 0.31
102 0.31
103 0.25
104 0.25
105 0.23
106 0.2
107 0.2
108 0.18
109 0.15
110 0.11
111 0.15
112 0.13
113 0.15
114 0.15
115 0.16
116 0.19
117 0.25
118 0.31
119 0.34
120 0.36
121 0.4
122 0.43
123 0.43
124 0.45