Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A225AB66

Protein Details
Accession A0A225AB66    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-77NPTVDNGKRRKIRQRLRQLLKRWPRSNNHydrophilic
NLS Segment(s)
PositionSequence
57-73KRRKIRQRLRQLLKRWP
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAYKTNYELWCQHCNPINNEEPDSPSGSTTMSTFEGSEDGSDYLFTPTTNPTVDNGKRRKIRQRLRQLLKRWPRSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.47
4 0.48
5 0.43
6 0.45
7 0.4
8 0.37
9 0.33
10 0.32
11 0.26
12 0.2
13 0.17
14 0.14
15 0.13
16 0.1
17 0.11
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.07
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.08
35 0.09
36 0.1
37 0.1
38 0.11
39 0.19
40 0.24
41 0.33
42 0.37
43 0.44
44 0.51
45 0.58
46 0.67
47 0.7
48 0.76
49 0.77
50 0.83
51 0.85
52 0.89
53 0.91
54 0.88
55 0.88
56 0.88
57 0.88