Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225AUC1

Protein Details
Accession A0A225AUC1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
18-48QHASVRAKKYDVKRGRRRRKPSHDLRDEESGBasic
NLS Segment(s)
PositionSequence
24-38AKKYDVKRGRRRRKP
Subcellular Location(s) nucl 10, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007224  TIF_Rrn11  
Gene Ontology GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
Pfam View protein in Pfam  
PF04090  RNA_pol_I_TF  
Amino Acid Sequences MIQPKVSVFSLPLVAWQQHASVRAKKYDVKRGRRRRKPSHDLRDEESGVDESGLETTDAESGYESSRSRAQSVVLTPEEARQYRAAGLSLDEELFEEDFPHVGLRDKSLERKRANDYVEDLQNQWPPIFLPGSKTTESTLHVRHLGVLTTILHKCLLEGDFVRAGRAWSMLLHERFGRQPVDIRSGGRWGIGAEILFRQNSTSGTVFTRPGFEAAKAYYERLIIQFPSRNARTEASGSLHFYPAMFTLWIYVVEQESAKAREALEYEEDENVSENPSESGDHVMSDPENNTDRNRDILSRRAKIRQKELAGAQEIATRMDDVMVGPPYSDSPALLQLRGMIALWLGDLYVLSLARDDEDIDMLDDDDEDYNVSSDRLIANRELHIALGKRVAEVAKANELFGKAKRRREGADEPAEEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.21
5 0.2
6 0.27
7 0.29
8 0.33
9 0.38
10 0.42
11 0.45
12 0.51
13 0.57
14 0.62
15 0.67
16 0.7
17 0.76
18 0.82
19 0.89
20 0.91
21 0.94
22 0.94
23 0.95
24 0.95
25 0.95
26 0.95
27 0.94
28 0.89
29 0.82
30 0.79
31 0.69
32 0.58
33 0.49
34 0.39
35 0.29
36 0.23
37 0.18
38 0.1
39 0.09
40 0.09
41 0.07
42 0.06
43 0.06
44 0.08
45 0.08
46 0.07
47 0.08
48 0.08
49 0.1
50 0.13
51 0.13
52 0.14
53 0.19
54 0.21
55 0.22
56 0.22
57 0.22
58 0.24
59 0.27
60 0.31
61 0.26
62 0.27
63 0.26
64 0.28
65 0.33
66 0.28
67 0.27
68 0.22
69 0.22
70 0.22
71 0.23
72 0.2
73 0.14
74 0.15
75 0.14
76 0.14
77 0.13
78 0.1
79 0.1
80 0.1
81 0.1
82 0.09
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.1
90 0.11
91 0.13
92 0.18
93 0.21
94 0.3
95 0.38
96 0.47
97 0.46
98 0.51
99 0.55
100 0.56
101 0.56
102 0.49
103 0.46
104 0.43
105 0.44
106 0.39
107 0.35
108 0.31
109 0.32
110 0.29
111 0.24
112 0.19
113 0.15
114 0.16
115 0.16
116 0.12
117 0.15
118 0.19
119 0.24
120 0.24
121 0.25
122 0.24
123 0.24
124 0.27
125 0.26
126 0.23
127 0.22
128 0.22
129 0.22
130 0.22
131 0.2
132 0.18
133 0.14
134 0.12
135 0.1
136 0.13
137 0.14
138 0.13
139 0.12
140 0.12
141 0.11
142 0.13
143 0.12
144 0.1
145 0.11
146 0.13
147 0.15
148 0.15
149 0.16
150 0.13
151 0.13
152 0.11
153 0.11
154 0.09
155 0.06
156 0.09
157 0.15
158 0.15
159 0.16
160 0.16
161 0.18
162 0.18
163 0.21
164 0.18
165 0.13
166 0.18
167 0.19
168 0.24
169 0.24
170 0.24
171 0.22
172 0.24
173 0.23
174 0.18
175 0.15
176 0.09
177 0.09
178 0.08
179 0.07
180 0.06
181 0.07
182 0.08
183 0.08
184 0.07
185 0.07
186 0.07
187 0.08
188 0.1
189 0.09
190 0.09
191 0.11
192 0.13
193 0.14
194 0.13
195 0.15
196 0.12
197 0.13
198 0.13
199 0.12
200 0.12
201 0.11
202 0.14
203 0.12
204 0.13
205 0.12
206 0.11
207 0.12
208 0.11
209 0.12
210 0.09
211 0.12
212 0.15
213 0.15
214 0.22
215 0.22
216 0.23
217 0.24
218 0.24
219 0.23
220 0.22
221 0.22
222 0.18
223 0.18
224 0.19
225 0.18
226 0.17
227 0.15
228 0.13
229 0.12
230 0.1
231 0.09
232 0.07
233 0.06
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.06
240 0.07
241 0.07
242 0.07
243 0.09
244 0.1
245 0.1
246 0.11
247 0.1
248 0.12
249 0.13
250 0.14
251 0.14
252 0.14
253 0.14
254 0.14
255 0.14
256 0.12
257 0.12
258 0.1
259 0.09
260 0.08
261 0.07
262 0.07
263 0.07
264 0.08
265 0.08
266 0.1
267 0.09
268 0.1
269 0.1
270 0.1
271 0.1
272 0.11
273 0.11
274 0.11
275 0.13
276 0.14
277 0.15
278 0.18
279 0.19
280 0.2
281 0.21
282 0.23
283 0.25
284 0.32
285 0.39
286 0.42
287 0.46
288 0.52
289 0.58
290 0.6
291 0.65
292 0.65
293 0.6
294 0.59
295 0.58
296 0.55
297 0.5
298 0.44
299 0.35
300 0.3
301 0.27
302 0.22
303 0.18
304 0.12
305 0.1
306 0.09
307 0.09
308 0.06
309 0.1
310 0.1
311 0.1
312 0.1
313 0.1
314 0.11
315 0.12
316 0.12
317 0.09
318 0.09
319 0.17
320 0.18
321 0.18
322 0.17
323 0.16
324 0.17
325 0.17
326 0.15
327 0.08
328 0.06
329 0.06
330 0.06
331 0.05
332 0.04
333 0.03
334 0.03
335 0.04
336 0.05
337 0.05
338 0.05
339 0.06
340 0.06
341 0.07
342 0.07
343 0.08
344 0.07
345 0.08
346 0.09
347 0.09
348 0.09
349 0.09
350 0.09
351 0.08
352 0.08
353 0.08
354 0.07
355 0.07
356 0.07
357 0.07
358 0.08
359 0.08
360 0.07
361 0.08
362 0.1
363 0.12
364 0.14
365 0.18
366 0.2
367 0.22
368 0.24
369 0.23
370 0.21
371 0.24
372 0.23
373 0.22
374 0.24
375 0.23
376 0.2
377 0.22
378 0.22
379 0.2
380 0.22
381 0.24
382 0.28
383 0.28
384 0.28
385 0.28
386 0.3
387 0.3
388 0.32
389 0.39
390 0.38
391 0.47
392 0.54
393 0.57
394 0.59
395 0.64
396 0.68
397 0.67
398 0.7
399 0.63