Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225AYB2

Protein Details
Accession A0A225AYB2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-124SRQQIRPRKSCNSPRRAQMRKVWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.833, nucl 12.5, cyto 12, cyto_pero 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR044152  YqjM-like  
Gene Ontology GO:0010181  F:FMN binding  
GO:0050661  F:NADP binding  
GO:0003959  F:NADPH dehydrogenase activity  
Amino Acid Sequences VRKAIPPDMPLFLRISSTDTMEDTELDKTLGSWDVESTIRVARELPALGVDLLDISSDGNNPGQLFDGVNVIDFYVNIAGRIRDTIHVEGLELLIGAVCMISRQQIRPRKSCNSPRRAQMRKVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.18
5 0.17
6 0.15
7 0.17
8 0.16
9 0.16
10 0.13
11 0.13
12 0.11
13 0.1
14 0.09
15 0.08
16 0.09
17 0.11
18 0.1
19 0.09
20 0.09
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.1
30 0.12
31 0.12
32 0.1
33 0.08
34 0.09
35 0.08
36 0.08
37 0.06
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09
70 0.09
71 0.13
72 0.14
73 0.15
74 0.15
75 0.15
76 0.14
77 0.13
78 0.11
79 0.07
80 0.05
81 0.03
82 0.03
83 0.03
84 0.02
85 0.02
86 0.03
87 0.03
88 0.07
89 0.1
90 0.16
91 0.25
92 0.34
93 0.42
94 0.5
95 0.58
96 0.63
97 0.71
98 0.77
99 0.78
100 0.79
101 0.8
102 0.81
103 0.84
104 0.84