Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A225AU81

Protein Details
Accession A0A225AU81    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-42VREPTNKRSKAQQKLRRRKGLFKKAKEFIHydrophilic
NLS Segment(s)
PositionSequence
19-39NKRSKAQQKLRRRKGLFKKAK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MSSPSPSPSPGPDVREPTNKRSKAQQKLRRRKGLFKKAKEFITKCDSDVYLIVRNRKTGQIHYLNSDSSGEWPPAHQSLRKYEAGKHQTLDSCKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.56
4 0.58
5 0.64
6 0.6
7 0.56
8 0.6
9 0.65
10 0.66
11 0.72
12 0.73
13 0.74
14 0.83
15 0.91
16 0.91
17 0.86
18 0.85
19 0.85
20 0.86
21 0.85
22 0.83
23 0.81
24 0.76
25 0.77
26 0.75
27 0.65
28 0.59
29 0.55
30 0.47
31 0.39
32 0.35
33 0.29
34 0.22
35 0.21
36 0.18
37 0.17
38 0.19
39 0.23
40 0.22
41 0.24
42 0.25
43 0.28
44 0.29
45 0.26
46 0.32
47 0.35
48 0.35
49 0.38
50 0.38
51 0.33
52 0.31
53 0.29
54 0.21
55 0.16
56 0.17
57 0.14
58 0.13
59 0.13
60 0.16
61 0.19
62 0.21
63 0.22
64 0.24
65 0.31
66 0.37
67 0.42
68 0.4
69 0.42
70 0.51
71 0.54
72 0.53
73 0.48
74 0.47
75 0.48