Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061APP8

Protein Details
Accession A0A061APP8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAKSKNHTNHNQNKKAHRNGIKKPKTNKYPSMHydrophilic
NLS Segment(s)
PositionSequence
14-40KKAHRNGIKKPKTNKYPSMKGVDPKFR
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTNKYPSMKGVDPKFRRNARYAAQGTQKALAAARKEAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.85
8 0.84
9 0.82
10 0.82
11 0.82
12 0.82
13 0.8
14 0.79
15 0.76
16 0.74
17 0.7
18 0.68
19 0.6
20 0.56
21 0.55
22 0.56
23 0.52
24 0.5
25 0.54
26 0.54
27 0.55
28 0.53
29 0.53
30 0.47
31 0.53
32 0.5
33 0.47
34 0.49
35 0.49
36 0.46
37 0.42
38 0.38
39 0.29
40 0.28
41 0.26
42 0.21
43 0.21
44 0.22