Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061AUV7

Protein Details
Accession A0A061AUV7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24VTLRTRKSYSTKSNGKRIVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVQRVTLRTRKSYSTKSNGKRIVKTPGGKLRYLTVKKAAAAPKCGDCHIALPGVPALRPRQYAQISKREKTVQRAYGGSRCANCVRDRIVRAFLVEEAKIVKRVLAQQQAKKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.73
4 0.79
5 0.8
6 0.79
7 0.76
8 0.71
9 0.7
10 0.67
11 0.64
12 0.63
13 0.63
14 0.6
15 0.54
16 0.51
17 0.47
18 0.49
19 0.47
20 0.41
21 0.38
22 0.36
23 0.36
24 0.41
25 0.42
26 0.34
27 0.35
28 0.34
29 0.33
30 0.32
31 0.32
32 0.27
33 0.21
34 0.2
35 0.17
36 0.15
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.2
48 0.23
49 0.3
50 0.34
51 0.42
52 0.45
53 0.45
54 0.48
55 0.48
56 0.48
57 0.49
58 0.52
59 0.47
60 0.44
61 0.46
62 0.45
63 0.43
64 0.43
65 0.38
66 0.3
67 0.29
68 0.29
69 0.3
70 0.28
71 0.27
72 0.29
73 0.32
74 0.35
75 0.35
76 0.36
77 0.34
78 0.33
79 0.31
80 0.28
81 0.24
82 0.2
83 0.17
84 0.17
85 0.18
86 0.19
87 0.17
88 0.16
89 0.17
90 0.23
91 0.31
92 0.38
93 0.45
94 0.5
95 0.61