Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZR03

Protein Details
Accession G8ZR03    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
74-95KYLKYLTKKYLKKNQLRDWIRFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, cyto_nucl 9.5, mito 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tdl:TDEL_0C00560  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPNTSRKQKITKTFTVDVSSPVENGVFDPASYAKYLIDHIKVDGAIGNLGNDVTVEENGNVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSSKTNQYKLAFYQVTPEDEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.61
4 0.53
5 0.45
6 0.4
7 0.32
8 0.24
9 0.2
10 0.17
11 0.13
12 0.12
13 0.13
14 0.09
15 0.08
16 0.1
17 0.1
18 0.1
19 0.11
20 0.11
21 0.08
22 0.08
23 0.11
24 0.12
25 0.14
26 0.13
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.09
33 0.08
34 0.07
35 0.07
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.05
56 0.08
57 0.08
58 0.09
59 0.16
60 0.17
61 0.22
62 0.26
63 0.35
64 0.38
65 0.42
66 0.49
67 0.52
68 0.58
69 0.62
70 0.67
71 0.68
72 0.72
73 0.79
74 0.8
75 0.81
76 0.8
77 0.76
78 0.72
79 0.66
80 0.6
81 0.51
82 0.44
83 0.43
84 0.43
85 0.48
86 0.47
87 0.47
88 0.49
89 0.49
90 0.51
91 0.44
92 0.47
93 0.39
94 0.34
95 0.37
96 0.35
97 0.35
98 0.34
99 0.32