Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CH68

Protein Details
Accession A0A0K3CH68   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-58VEEELAWQRKPKRRRWDWRTGVLGVHydrophilic
NLS Segment(s)
PositionSequence
43-47KPKRR
Subcellular Location(s) nucl 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001503  Glyco_trans_10  
IPR038577  GT10-like_C_sf  
Gene Ontology GO:0032580  C:Golgi cisterna membrane  
GO:0008417  F:fucosyltransferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF00852  Glyco_transf_10  
Amino Acid Sequences MSARQPEAVGLTTFSESDLEANELEGVEEELAAVEEELAWQRKPKRRRWDWRTGVLGVTAGCLLGYLATRSAGSFGMTASSKEAVLVEEDTLAGNITGPAVRLHYRHDDKTNQGDPILQPTCPVSVIYTEDETAADVLVLNVDSHAGLEDEEFERLRKERPWQKFAAWAVESAPNRPFLERHFNKLREGKRNETYDFEVTYRLNSTVPATYSYSYFNYSNSPLPVDQKRDDKIAAAFITNCQPKNARSLVLDELVSLLPGKIDSFGSCHNNADIDSTLHELGIYDDVGTHTKWNEKITLISRYRFTVAFENSNDLDYATEKYFQALERGSVPLVYGPPEAAARFFPSPTAAIDLADYLPSNYTSQSTIDSEEPKELSPEAKAGIKRLADRLEYLSSEEGREEYEDMLAWKKDTAWLEDERNPLGKVVRQANSPYPQDCRLAGAYLGEAWARNSWVPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.11
5 0.11
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.05
18 0.06
19 0.06
20 0.05
21 0.04
22 0.04
23 0.06
24 0.1
25 0.13
26 0.13
27 0.2
28 0.29
29 0.38
30 0.48
31 0.57
32 0.64
33 0.73
34 0.83
35 0.86
36 0.89
37 0.89
38 0.89
39 0.85
40 0.76
41 0.65
42 0.55
43 0.46
44 0.35
45 0.26
46 0.17
47 0.1
48 0.08
49 0.06
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.08
57 0.08
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.11
64 0.11
65 0.11
66 0.12
67 0.13
68 0.12
69 0.12
70 0.12
71 0.09
72 0.11
73 0.11
74 0.09
75 0.08
76 0.09
77 0.08
78 0.08
79 0.08
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.09
88 0.12
89 0.12
90 0.17
91 0.26
92 0.32
93 0.36
94 0.42
95 0.45
96 0.48
97 0.56
98 0.55
99 0.46
100 0.41
101 0.39
102 0.33
103 0.36
104 0.32
105 0.23
106 0.2
107 0.2
108 0.2
109 0.17
110 0.17
111 0.09
112 0.1
113 0.13
114 0.14
115 0.14
116 0.14
117 0.13
118 0.13
119 0.12
120 0.11
121 0.08
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.06
137 0.07
138 0.08
139 0.08
140 0.08
141 0.1
142 0.12
143 0.14
144 0.16
145 0.25
146 0.34
147 0.42
148 0.48
149 0.49
150 0.5
151 0.54
152 0.52
153 0.49
154 0.4
155 0.32
156 0.28
157 0.3
158 0.29
159 0.24
160 0.23
161 0.19
162 0.2
163 0.2
164 0.19
165 0.17
166 0.28
167 0.28
168 0.35
169 0.41
170 0.42
171 0.47
172 0.54
173 0.56
174 0.55
175 0.59
176 0.58
177 0.56
178 0.59
179 0.54
180 0.5
181 0.47
182 0.38
183 0.34
184 0.28
185 0.23
186 0.19
187 0.18
188 0.16
189 0.13
190 0.11
191 0.1
192 0.11
193 0.1
194 0.11
195 0.12
196 0.13
197 0.12
198 0.13
199 0.15
200 0.14
201 0.15
202 0.15
203 0.13
204 0.14
205 0.15
206 0.16
207 0.15
208 0.16
209 0.14
210 0.18
211 0.21
212 0.24
213 0.25
214 0.28
215 0.29
216 0.29
217 0.28
218 0.25
219 0.22
220 0.2
221 0.17
222 0.13
223 0.12
224 0.11
225 0.17
226 0.18
227 0.18
228 0.16
229 0.17
230 0.17
231 0.23
232 0.23
233 0.19
234 0.18
235 0.21
236 0.21
237 0.21
238 0.2
239 0.14
240 0.14
241 0.12
242 0.11
243 0.08
244 0.06
245 0.04
246 0.04
247 0.05
248 0.04
249 0.05
250 0.05
251 0.07
252 0.11
253 0.14
254 0.15
255 0.16
256 0.15
257 0.15
258 0.15
259 0.15
260 0.12
261 0.09
262 0.09
263 0.1
264 0.1
265 0.09
266 0.09
267 0.07
268 0.07
269 0.07
270 0.07
271 0.05
272 0.05
273 0.06
274 0.07
275 0.07
276 0.08
277 0.08
278 0.12
279 0.15
280 0.16
281 0.17
282 0.17
283 0.22
284 0.24
285 0.33
286 0.32
287 0.33
288 0.32
289 0.32
290 0.33
291 0.29
292 0.27
293 0.25
294 0.25
295 0.27
296 0.26
297 0.28
298 0.27
299 0.27
300 0.24
301 0.18
302 0.15
303 0.11
304 0.13
305 0.1
306 0.12
307 0.11
308 0.12
309 0.14
310 0.13
311 0.16
312 0.14
313 0.14
314 0.14
315 0.15
316 0.14
317 0.13
318 0.13
319 0.11
320 0.11
321 0.12
322 0.1
323 0.09
324 0.1
325 0.11
326 0.11
327 0.1
328 0.1
329 0.12
330 0.13
331 0.13
332 0.13
333 0.14
334 0.14
335 0.14
336 0.17
337 0.14
338 0.13
339 0.13
340 0.13
341 0.12
342 0.12
343 0.11
344 0.07
345 0.08
346 0.09
347 0.09
348 0.09
349 0.1
350 0.1
351 0.11
352 0.14
353 0.14
354 0.16
355 0.19
356 0.22
357 0.22
358 0.24
359 0.24
360 0.21
361 0.22
362 0.2
363 0.17
364 0.15
365 0.16
366 0.15
367 0.19
368 0.2
369 0.21
370 0.26
371 0.28
372 0.29
373 0.33
374 0.35
375 0.31
376 0.33
377 0.34
378 0.32
379 0.29
380 0.29
381 0.27
382 0.23
383 0.22
384 0.21
385 0.17
386 0.15
387 0.16
388 0.14
389 0.11
390 0.11
391 0.11
392 0.12
393 0.16
394 0.16
395 0.15
396 0.15
397 0.15
398 0.2
399 0.22
400 0.24
401 0.24
402 0.29
403 0.34
404 0.4
405 0.42
406 0.4
407 0.4
408 0.36
409 0.34
410 0.32
411 0.3
412 0.32
413 0.37
414 0.38
415 0.39
416 0.44
417 0.5
418 0.54
419 0.54
420 0.5
421 0.47
422 0.47
423 0.46
424 0.41
425 0.38
426 0.32
427 0.29
428 0.26
429 0.22
430 0.2
431 0.17
432 0.17
433 0.13
434 0.12
435 0.12
436 0.13
437 0.14