Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CFJ1

Protein Details
Accession A0A0K3CFJ1    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-112EESRIKRNPRFRDNRVHALLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 12, cyto 10, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
Amino Acid Sequences MVVGQSGTGRTTFVNTLCEQPLIEHQQPVAPEEAHLESGIRINPVQVELEEDGVRVSLTVVDTPGFGDQIDNEFTFNEIMGYLERQYDDILAEESRIKRNPRFRDNRVHALLYFITPTGHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.22
4 0.23
5 0.23
6 0.2
7 0.19
8 0.24
9 0.28
10 0.28
11 0.25
12 0.24
13 0.26
14 0.26
15 0.26
16 0.22
17 0.14
18 0.12
19 0.14
20 0.15
21 0.13
22 0.13
23 0.12
24 0.09
25 0.11
26 0.12
27 0.1
28 0.09
29 0.08
30 0.09
31 0.09
32 0.09
33 0.07
34 0.09
35 0.09
36 0.11
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.06
65 0.04
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.13
81 0.15
82 0.2
83 0.25
84 0.29
85 0.35
86 0.45
87 0.54
88 0.6
89 0.68
90 0.7
91 0.76
92 0.79
93 0.82
94 0.77
95 0.7
96 0.59
97 0.54
98 0.48
99 0.38
100 0.3
101 0.21