Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZUW5

Protein Details
Accession G8ZUW5    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPQKALKVKQKVKDPRRVTKRQKNLRKGAPLQHydrophilic
NLS Segment(s)
PositionSequence
6-45LKVKQKVKDPRRVTKRQKNLRKGAPLQIKSKKKSLEHLKK
74-84RRELEKGKGKK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG tdl:TDEL_0E01660  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVKQKVKDPRRVTKRQKNLRKGAPLQIKSKKKSLEHLKKLNRTASLTESTERLIASKVGHLELLKGTRRELEKGKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.85
4 0.88
5 0.88
6 0.88
7 0.9
8 0.9
9 0.92
10 0.91
11 0.9
12 0.88
13 0.86
14 0.79
15 0.78
16 0.76
17 0.7
18 0.69
19 0.69
20 0.68
21 0.62
22 0.63
23 0.6
24 0.52
25 0.56
26 0.59
27 0.61
28 0.62
29 0.69
30 0.71
31 0.72
32 0.74
33 0.68
34 0.59
35 0.5
36 0.43
37 0.37
38 0.33
39 0.28
40 0.25
41 0.22
42 0.21
43 0.19
44 0.16
45 0.13
46 0.1
47 0.1
48 0.1
49 0.12
50 0.13
51 0.12
52 0.14
53 0.13
54 0.14
55 0.16
56 0.21
57 0.24
58 0.23
59 0.24
60 0.29
61 0.32
62 0.36
63 0.39
64 0.43