Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CI76

Protein Details
Accession A0A0K3CI76    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-65ELNCNPVRRRRTQTRRFRSTDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018028  Catalase  
IPR024712  Catalase_clade2  
IPR011614  Catalase_core  
IPR002226  Catalase_haem_BS  
IPR020835  Catalase_sf  
Gene Ontology GO:0004096  F:catalase activity  
GO:0020037  F:heme binding  
GO:0006979  P:response to oxidative stress  
Pfam View protein in Pfam  
PF00199  Catalase  
PROSITE View protein in PROSITE  
PS00437  CATALASE_1  
PS51402  CATALASE_3  
Amino Acid Sequences MEAGWCVGRLISEEQELTFDFDILDCTKLVPEELVPITWVGTMELNCNPVRRRRTQTRRFRSTDLLLLPQTNYFAETEQVAFCTSNIVPGMSYSNDPMLQLRNFSYFDTQISRLGGVNFNELPIKRSVCRAVRLALQCWYDAGAVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.19
5 0.15
6 0.13
7 0.11
8 0.1
9 0.12
10 0.12
11 0.12
12 0.09
13 0.09
14 0.1
15 0.1
16 0.1
17 0.09
18 0.08
19 0.11
20 0.12
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.1
27 0.07
28 0.08
29 0.08
30 0.1
31 0.11
32 0.13
33 0.14
34 0.17
35 0.19
36 0.25
37 0.3
38 0.35
39 0.43
40 0.51
41 0.62
42 0.69
43 0.78
44 0.81
45 0.84
46 0.81
47 0.76
48 0.7
49 0.62
50 0.56
51 0.46
52 0.39
53 0.3
54 0.26
55 0.23
56 0.17
57 0.15
58 0.1
59 0.09
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.06
66 0.07
67 0.07
68 0.07
69 0.06
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.11
78 0.09
79 0.1
80 0.09
81 0.1
82 0.1
83 0.1
84 0.11
85 0.13
86 0.13
87 0.14
88 0.14
89 0.16
90 0.17
91 0.18
92 0.2
93 0.16
94 0.18
95 0.2
96 0.2
97 0.19
98 0.19
99 0.19
100 0.17
101 0.18
102 0.2
103 0.17
104 0.2
105 0.18
106 0.18
107 0.21
108 0.2
109 0.21
110 0.21
111 0.24
112 0.21
113 0.26
114 0.33
115 0.35
116 0.4
117 0.4
118 0.4
119 0.45
120 0.48
121 0.46
122 0.44
123 0.4
124 0.35
125 0.32
126 0.3