Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3C929

Protein Details
Accession A0A0K3C929    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
159-178EPKKEEPKKDESKPEPKKEEAcidic
NLS Segment(s)
PositionSequence
143-205GGAKKEEAPKEEPKQDEPKKEEPKKDESKPEPKKEEAIPEAKSEYRKPDSAQPAPKAPEPSKK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR003016  2-oxoA_DH_lipoyl-BS  
IPR000089  Biotin_lipoyl  
IPR011053  Single_hybrid_motif  
Pfam View protein in Pfam  
PF00364  Biotin_lipoyl  
PROSITE View protein in PROSITE  
PS50968  BIOTINYL_LIPOYL  
PS00189  LIPOYL  
CDD cd06849  lipoyl_domain  
Amino Acid Sequences MLAARNTPRALSRCARPAAASAARQTLLSRASLTAGVARTAPRLAAPAFSRSFHASPLTLDEIVKVPSMAESITEGTLKQWLKQKGDYVEADEEVATIETDKIDVAVNAPKAGVLTELLANEEDTVAVGQDLFKLDPNGKAEGGAKKEEAPKEEPKQDEPKKEEPKKDESKPEPKKEEAIPEAKSEYRKPDSAQPAPKAPEPSKKEEGKTAAQSPAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.43
4 0.42
5 0.43
6 0.42
7 0.38
8 0.32
9 0.33
10 0.32
11 0.31
12 0.28
13 0.24
14 0.2
15 0.18
16 0.16
17 0.13
18 0.14
19 0.15
20 0.14
21 0.15
22 0.14
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.13
29 0.1
30 0.12
31 0.12
32 0.15
33 0.16
34 0.2
35 0.22
36 0.22
37 0.25
38 0.27
39 0.27
40 0.24
41 0.24
42 0.19
43 0.18
44 0.21
45 0.21
46 0.17
47 0.16
48 0.16
49 0.15
50 0.15
51 0.15
52 0.1
53 0.08
54 0.07
55 0.08
56 0.06
57 0.05
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.13
65 0.13
66 0.15
67 0.22
68 0.26
69 0.29
70 0.32
71 0.36
72 0.33
73 0.37
74 0.34
75 0.31
76 0.27
77 0.24
78 0.21
79 0.16
80 0.13
81 0.09
82 0.09
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.08
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.07
101 0.04
102 0.04
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.06
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.05
120 0.06
121 0.07
122 0.08
123 0.12
124 0.14
125 0.15
126 0.14
127 0.15
128 0.18
129 0.21
130 0.23
131 0.21
132 0.2
133 0.21
134 0.27
135 0.28
136 0.29
137 0.3
138 0.35
139 0.4
140 0.45
141 0.45
142 0.45
143 0.54
144 0.56
145 0.59
146 0.58
147 0.62
148 0.67
149 0.72
150 0.75
151 0.7
152 0.73
153 0.73
154 0.74
155 0.74
156 0.72
157 0.75
158 0.78
159 0.82
160 0.78
161 0.71
162 0.69
163 0.63
164 0.62
165 0.57
166 0.53
167 0.45
168 0.42
169 0.42
170 0.41
171 0.41
172 0.36
173 0.37
174 0.37
175 0.38
176 0.38
177 0.44
178 0.51
179 0.56
180 0.61
181 0.58
182 0.6
183 0.61
184 0.63
185 0.61
186 0.57
187 0.58
188 0.56
189 0.59
190 0.61
191 0.63
192 0.62
193 0.62
194 0.63
195 0.6
196 0.61
197 0.57
198 0.52
199 0.47