Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZNM7

Protein Details
Accession G8ZNM7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-36DAPDVPKKKAPHQKKAPQKKANVTAKKVHydrophilic
NLS Segment(s)
PositionSequence
14-64PKKKAPHQKKAPQKKANVTAKKVQEEKPRLTFSLKEKPKDNTDKKALLKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020401  mRNA_transport_factor_GFD1  
KEGG tdl:TDEL_0B00920  -  
Pfam View protein in Pfam  
PF17331  GFD1  
Amino Acid Sequences MVLESKWADAPDVPKKKAPHQKKAPQKKANVTAKKVQEEKPRLTFSLKEKPKDNTDKKALLKKKIEEQRQIYEKNQHQKQQKELLESFLNDDGGFQWSDEDEEDKILEKLNTSLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.56
4 0.64
5 0.67
6 0.68
7 0.7
8 0.77
9 0.83
10 0.91
11 0.92
12 0.89
13 0.87
14 0.85
15 0.85
16 0.86
17 0.83
18 0.76
19 0.73
20 0.71
21 0.69
22 0.64
23 0.61
24 0.6
25 0.59
26 0.59
27 0.58
28 0.54
29 0.49
30 0.46
31 0.44
32 0.41
33 0.45
34 0.44
35 0.41
36 0.42
37 0.44
38 0.5
39 0.56
40 0.55
41 0.52
42 0.53
43 0.56
44 0.56
45 0.61
46 0.58
47 0.56
48 0.56
49 0.51
50 0.54
51 0.56
52 0.58
53 0.57
54 0.57
55 0.57
56 0.58
57 0.58
58 0.52
59 0.53
60 0.52
61 0.54
62 0.55
63 0.54
64 0.56
65 0.58
66 0.62
67 0.63
68 0.6
69 0.57
70 0.52
71 0.5
72 0.44
73 0.39
74 0.35
75 0.26
76 0.23
77 0.16
78 0.16
79 0.12
80 0.12
81 0.11
82 0.09
83 0.08
84 0.08
85 0.09
86 0.1
87 0.11
88 0.09
89 0.1
90 0.11
91 0.12
92 0.12
93 0.14
94 0.13
95 0.13
96 0.16