Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CBS6

Protein Details
Accession A0A0K3CBS6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
52-75MFKVIKTGKSKRKGWKRMVTKATFHydrophilic
NLS Segment(s)
PositionSequence
27-45KQKRKEKAGKFAVPLPKVR
54-68KVIKTGKSKRKGWKR
Subcellular Location(s) cyto 18.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences MPEGALPTYLLDREGQNDAKALSSAVKQKRKEKAGKFAVPLPKVRGIAEDEMFKVIKTGKSKRKGWKRMVTKATFVGEDFTRKPPKLERFIRPSALRMKKANVTHPELKATFQLPIIGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGLVTAGGKVVWGKYAQITNNPDLDGTCNAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.21
5 0.2
6 0.2
7 0.19
8 0.16
9 0.13
10 0.16
11 0.24
12 0.32
13 0.4
14 0.45
15 0.53
16 0.62
17 0.7
18 0.75
19 0.74
20 0.76
21 0.77
22 0.78
23 0.72
24 0.7
25 0.69
26 0.62
27 0.57
28 0.51
29 0.46
30 0.41
31 0.38
32 0.33
33 0.28
34 0.29
35 0.27
36 0.24
37 0.2
38 0.21
39 0.2
40 0.18
41 0.15
42 0.13
43 0.16
44 0.21
45 0.3
46 0.37
47 0.46
48 0.54
49 0.63
50 0.72
51 0.78
52 0.81
53 0.82
54 0.82
55 0.83
56 0.84
57 0.76
58 0.68
59 0.61
60 0.52
61 0.42
62 0.33
63 0.26
64 0.17
65 0.18
66 0.17
67 0.2
68 0.23
69 0.23
70 0.24
71 0.3
72 0.36
73 0.42
74 0.47
75 0.49
76 0.51
77 0.54
78 0.58
79 0.51
80 0.47
81 0.48
82 0.47
83 0.44
84 0.38
85 0.38
86 0.39
87 0.41
88 0.45
89 0.4
90 0.41
91 0.43
92 0.42
93 0.43
94 0.37
95 0.36
96 0.3
97 0.25
98 0.2
99 0.14
100 0.14
101 0.11
102 0.15
103 0.16
104 0.16
105 0.16
106 0.2
107 0.25
108 0.28
109 0.3
110 0.27
111 0.29
112 0.3
113 0.36
114 0.36
115 0.31
116 0.27
117 0.28
118 0.28
119 0.25
120 0.22
121 0.16
122 0.11
123 0.11
124 0.11
125 0.08
126 0.06
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.08
133 0.08
134 0.08
135 0.06
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.08
145 0.08
146 0.09
147 0.13
148 0.19
149 0.21
150 0.28
151 0.33
152 0.35
153 0.36
154 0.35
155 0.32
156 0.27
157 0.28
158 0.23
159 0.21
160 0.17