Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3C9X7

Protein Details
Accession A0A0K3C9X7    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-103LLSSEKKHKHLEKQKREGVLBasic
NLS Segment(s)
Subcellular Location(s) cysk 11, cyto_nucl 9.5, cyto 9, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Amino Acid Sequences MDPLGNLQFTTSGALIELVDTNLVLTQTIERLFHPPSKSYAQTDRGVFLVRGENVVLLGEVDLDTEDLPLSRLTLLPWSSLSVLLSSEKKHKHLEKQKREGVLFEKCGFGEEGGEGDAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.08
15 0.09
16 0.1
17 0.1
18 0.13
19 0.16
20 0.21
21 0.22
22 0.22
23 0.26
24 0.3
25 0.31
26 0.33
27 0.36
28 0.36
29 0.38
30 0.37
31 0.33
32 0.29
33 0.28
34 0.23
35 0.18
36 0.16
37 0.12
38 0.12
39 0.11
40 0.1
41 0.09
42 0.09
43 0.07
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.09
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.12
68 0.12
69 0.08
70 0.09
71 0.11
72 0.12
73 0.13
74 0.2
75 0.23
76 0.26
77 0.35
78 0.4
79 0.48
80 0.58
81 0.67
82 0.71
83 0.78
84 0.8
85 0.79
86 0.73
87 0.67
88 0.62
89 0.59
90 0.53
91 0.44
92 0.4
93 0.33
94 0.33
95 0.3
96 0.24
97 0.17
98 0.12
99 0.12