Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CAN5

Protein Details
Accession A0A0K3CAN5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
190-221VLQRDFFRMRQDQKRREWEKKDAEKRGKEWSFHydrophilic
NLS Segment(s)
PositionSequence
204-217RREWEKKDAEKRGK
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MTTPPGGLPSPPTASSSSSTTPGPPRLVNLYHVRTVATSKSCWICHRETTCCLATEGVTDFIYACKSHLLDPGFAKPAPSTSTPSASPSGSPAPSPVPQSEIDKVKQEYEEKQKRKAEAEKGDKDKDAKSSSSTAGAAASTAFSLFRTGASALSSLSSTASSTLFPAPPPTPPSLAETQRAAAASAKTFVLQRDFFRMRQDQKRREWEKKDAEKRGKEWSFPKAPTGGLPSLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.27
5 0.25
6 0.25
7 0.28
8 0.32
9 0.34
10 0.35
11 0.31
12 0.32
13 0.35
14 0.36
15 0.37
16 0.4
17 0.39
18 0.38
19 0.38
20 0.35
21 0.3
22 0.3
23 0.3
24 0.25
25 0.21
26 0.23
27 0.28
28 0.3
29 0.33
30 0.36
31 0.34
32 0.4
33 0.44
34 0.45
35 0.43
36 0.46
37 0.45
38 0.4
39 0.37
40 0.29
41 0.23
42 0.2
43 0.18
44 0.14
45 0.12
46 0.11
47 0.1
48 0.1
49 0.12
50 0.1
51 0.08
52 0.09
53 0.09
54 0.11
55 0.16
56 0.17
57 0.19
58 0.21
59 0.24
60 0.25
61 0.24
62 0.23
63 0.18
64 0.18
65 0.18
66 0.18
67 0.2
68 0.19
69 0.22
70 0.22
71 0.24
72 0.24
73 0.21
74 0.2
75 0.18
76 0.19
77 0.16
78 0.16
79 0.14
80 0.15
81 0.17
82 0.19
83 0.16
84 0.16
85 0.17
86 0.2
87 0.23
88 0.23
89 0.23
90 0.25
91 0.25
92 0.24
93 0.25
94 0.24
95 0.26
96 0.33
97 0.42
98 0.41
99 0.48
100 0.5
101 0.5
102 0.53
103 0.54
104 0.51
105 0.51
106 0.57
107 0.57
108 0.58
109 0.58
110 0.54
111 0.49
112 0.42
113 0.37
114 0.31
115 0.24
116 0.21
117 0.22
118 0.21
119 0.21
120 0.2
121 0.15
122 0.13
123 0.11
124 0.09
125 0.06
126 0.06
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.07
140 0.08
141 0.08
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.07
148 0.06
149 0.08
150 0.1
151 0.1
152 0.1
153 0.15
154 0.14
155 0.17
156 0.21
157 0.22
158 0.22
159 0.22
160 0.27
161 0.29
162 0.32
163 0.31
164 0.29
165 0.27
166 0.27
167 0.26
168 0.22
169 0.18
170 0.17
171 0.15
172 0.14
173 0.14
174 0.13
175 0.14
176 0.15
177 0.18
178 0.19
179 0.2
180 0.28
181 0.32
182 0.32
183 0.38
184 0.45
185 0.48
186 0.57
187 0.65
188 0.65
189 0.71
190 0.81
191 0.83
192 0.85
193 0.84
194 0.83
195 0.84
196 0.86
197 0.86
198 0.86
199 0.87
200 0.84
201 0.8
202 0.81
203 0.73
204 0.69
205 0.64
206 0.63
207 0.62
208 0.56
209 0.57
210 0.48
211 0.45
212 0.42
213 0.43