Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3C980

Protein Details
Accession A0A0K3C980   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-135RSSGESVKRGRRRRLERTRSGRTRQABasic
NLS Segment(s)
PositionSequence
110-131RSSGESVKRGRRRRLERTRSGR
Subcellular Location(s) cyto 11, nucl 8, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008580  PPPDE_dom  
IPR042266  PPPDE_sf  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05903  Peptidase_C97  
PROSITE View protein in PROSITE  
PS51858  PPPDE  
Amino Acid Sequences MAARDADEPLQVQIVVYDLLPPSTLGSLLNFIGSGVYHSSVQLRIPLGPTDHSPNPTEYAYGGHDSPNVTGVFGIPAGTAAQRMPGLRYYSTLDAGTAFGEDWEKAFGRRSSGESVKRGRRRRLERTRSGRTRQASEEETIAGPPYGGWQSVDSQSTINLVESAQAPGRIPKMGLKADEDEDEADGSADEDEDEDDGGARDGTQYITKAERRAYRILQEMKADPAWNGTRYRLLEKNCNTFTDELVYRLTGRRAPGWLNRAAWVATSIPCIVPAGWIDEADEAAPSGDGVDLHDPAHMVSGDGELVIKPPRADRMDLGGRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.1
5 0.09
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.08
13 0.09
14 0.11
15 0.11
16 0.11
17 0.09
18 0.09
19 0.09
20 0.08
21 0.09
22 0.08
23 0.1
24 0.1
25 0.11
26 0.13
27 0.14
28 0.15
29 0.16
30 0.16
31 0.16
32 0.18
33 0.2
34 0.19
35 0.2
36 0.23
37 0.26
38 0.29
39 0.3
40 0.3
41 0.29
42 0.31
43 0.29
44 0.26
45 0.2
46 0.19
47 0.18
48 0.19
49 0.17
50 0.15
51 0.16
52 0.16
53 0.16
54 0.17
55 0.14
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.09
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.06
68 0.07
69 0.09
70 0.09
71 0.11
72 0.14
73 0.17
74 0.17
75 0.19
76 0.21
77 0.21
78 0.22
79 0.21
80 0.17
81 0.14
82 0.14
83 0.12
84 0.09
85 0.07
86 0.05
87 0.06
88 0.06
89 0.06
90 0.08
91 0.08
92 0.08
93 0.13
94 0.14
95 0.16
96 0.18
97 0.21
98 0.25
99 0.32
100 0.36
101 0.38
102 0.45
103 0.52
104 0.59
105 0.63
106 0.66
107 0.69
108 0.73
109 0.78
110 0.82
111 0.82
112 0.84
113 0.85
114 0.87
115 0.85
116 0.81
117 0.77
118 0.69
119 0.63
120 0.55
121 0.51
122 0.43
123 0.35
124 0.31
125 0.25
126 0.21
127 0.17
128 0.15
129 0.1
130 0.07
131 0.06
132 0.07
133 0.06
134 0.06
135 0.06
136 0.07
137 0.09
138 0.11
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1
144 0.09
145 0.07
146 0.06
147 0.05
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.09
155 0.1
156 0.09
157 0.09
158 0.11
159 0.15
160 0.17
161 0.18
162 0.18
163 0.19
164 0.2
165 0.2
166 0.18
167 0.13
168 0.12
169 0.11
170 0.09
171 0.07
172 0.05
173 0.05
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.03
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.07
192 0.09
193 0.14
194 0.16
195 0.18
196 0.23
197 0.28
198 0.32
199 0.36
200 0.37
201 0.37
202 0.43
203 0.45
204 0.42
205 0.4
206 0.37
207 0.34
208 0.33
209 0.29
210 0.21
211 0.21
212 0.21
213 0.2
214 0.21
215 0.19
216 0.23
217 0.25
218 0.31
219 0.31
220 0.33
221 0.4
222 0.44
223 0.51
224 0.47
225 0.47
226 0.44
227 0.39
228 0.35
229 0.32
230 0.27
231 0.19
232 0.19
233 0.18
234 0.17
235 0.19
236 0.2
237 0.17
238 0.19
239 0.2
240 0.22
241 0.26
242 0.32
243 0.35
244 0.37
245 0.36
246 0.36
247 0.35
248 0.32
249 0.27
250 0.22
251 0.18
252 0.14
253 0.15
254 0.14
255 0.12
256 0.13
257 0.13
258 0.11
259 0.11
260 0.11
261 0.13
262 0.12
263 0.12
264 0.13
265 0.12
266 0.12
267 0.11
268 0.1
269 0.06
270 0.06
271 0.06
272 0.05
273 0.05
274 0.05
275 0.05
276 0.07
277 0.09
278 0.1
279 0.1
280 0.11
281 0.11
282 0.1
283 0.13
284 0.11
285 0.09
286 0.09
287 0.1
288 0.09
289 0.09
290 0.09
291 0.07
292 0.09
293 0.12
294 0.14
295 0.14
296 0.17
297 0.25
298 0.28
299 0.32
300 0.32
301 0.38
302 0.45