Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CDA1

Protein Details
Accession A0A0K3CDA1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-44GSSSGGADKKKKKKSSTSKKVRQEEEAHydrophilic
NLS Segment(s)
PositionSequence
15-37KLKGSSSGGADKKKKKKSSTSKK
97-97K
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPASDYQHKPGGALKLKGSSSGGADKKKKKKSSTSKKVRQEEEAVLSGGGGSEGSGREEGGESSSGAAGSSAGVGKTEAQRRFEEVQRKRLLEKAAKAAAKSHKERVAEFNEKLENMSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.39
4 0.4
5 0.36
6 0.28
7 0.24
8 0.29
9 0.32
10 0.35
11 0.43
12 0.51
13 0.6
14 0.68
15 0.73
16 0.73
17 0.78
18 0.82
19 0.85
20 0.86
21 0.88
22 0.88
23 0.9
24 0.91
25 0.83
26 0.77
27 0.7
28 0.62
29 0.55
30 0.46
31 0.36
32 0.27
33 0.23
34 0.18
35 0.13
36 0.09
37 0.04
38 0.03
39 0.03
40 0.03
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.06
63 0.11
64 0.18
65 0.2
66 0.23
67 0.24
68 0.3
69 0.33
70 0.38
71 0.43
72 0.42
73 0.49
74 0.51
75 0.52
76 0.48
77 0.49
78 0.51
79 0.47
80 0.46
81 0.44
82 0.44
83 0.44
84 0.43
85 0.45
86 0.46
87 0.48
88 0.48
89 0.48
90 0.47
91 0.47
92 0.49
93 0.5
94 0.51
95 0.5
96 0.46
97 0.44
98 0.42
99 0.4
100 0.38
101 0.33
102 0.26
103 0.21
104 0.24
105 0.2
106 0.18
107 0.2
108 0.2
109 0.18