Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CEQ2

Protein Details
Accession A0A0K3CEQ2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
536-566GGRRGKTEEERERERRERRERGKPGSVRYRFBasic
NLS Segment(s)
PositionSequence
519-523KEREK
530-562AAGGAAGGRRGKTEEERERERRERRERGKPGSV
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
IPR006671  Cyclin_N  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
Amino Acid Sequences MAQLAGVPEPRPPRNPDSPPPLAVTRSFRPFYSPIEVEHLVHLQAQSRASASGGADGPAGEASGGLARKTMSDQRIESLRQLACGFIERVAGRLGFPRRTTATAQKLYHRFHLHFPLSDFAYQDVSLSALLVSAKLEDTLKKLRDIQIAAWKVQNMMDGGSGVGEGDPNTQEAHRPHLIGIERLILQTICFNFNLNRPLDSSPSAPSLPSDTDSLLTLATLSPSASAATSRDAFTHLLRLSSAIPSVPSALVRPSSPSTDSSLVEEVHKSLTYAAFLLLTDLHRTLAPLSYPPHTCAAACIWTAGFVLATAAARRKVENGSENGTGEKDEVVWDEDMLQGWAASCETLEADIDDIAQTLLNLLISLCPPQPTSASATANGLSVPLTTSPLFSPVSPAETSQSSSSTGAAKPVATSERDRHLLQTGVPTVFSHPDLLSQPISANDLMGVKIQLRKARAAAAANGKRDREEAGAAVEQGDDVTLHRSKRWQGLSDGLAEVGRIRDERDQKDRLRAEEKAEKEREKSENDASAAGGAAGGRRGKTEEERERERRERRERGKPGSVRYRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.66
4 0.68
5 0.69
6 0.66
7 0.63
8 0.59
9 0.52
10 0.48
11 0.46
12 0.44
13 0.46
14 0.45
15 0.4
16 0.43
17 0.43
18 0.43
19 0.45
20 0.4
21 0.34
22 0.4
23 0.41
24 0.36
25 0.35
26 0.31
27 0.23
28 0.24
29 0.22
30 0.18
31 0.2
32 0.19
33 0.18
34 0.17
35 0.17
36 0.16
37 0.17
38 0.14
39 0.15
40 0.15
41 0.15
42 0.14
43 0.13
44 0.13
45 0.11
46 0.1
47 0.06
48 0.05
49 0.05
50 0.08
51 0.09
52 0.09
53 0.09
54 0.1
55 0.11
56 0.16
57 0.23
58 0.23
59 0.28
60 0.3
61 0.34
62 0.39
63 0.4
64 0.38
65 0.38
66 0.34
67 0.32
68 0.3
69 0.26
70 0.21
71 0.23
72 0.21
73 0.15
74 0.19
75 0.16
76 0.17
77 0.18
78 0.18
79 0.15
80 0.21
81 0.26
82 0.27
83 0.28
84 0.32
85 0.33
86 0.37
87 0.41
88 0.44
89 0.48
90 0.51
91 0.52
92 0.56
93 0.61
94 0.6
95 0.63
96 0.59
97 0.52
98 0.49
99 0.56
100 0.51
101 0.46
102 0.44
103 0.4
104 0.36
105 0.35
106 0.3
107 0.21
108 0.2
109 0.17
110 0.15
111 0.11
112 0.1
113 0.08
114 0.08
115 0.07
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.08
124 0.08
125 0.13
126 0.21
127 0.22
128 0.24
129 0.29
130 0.33
131 0.38
132 0.38
133 0.38
134 0.4
135 0.41
136 0.4
137 0.38
138 0.32
139 0.28
140 0.26
141 0.23
142 0.14
143 0.12
144 0.11
145 0.09
146 0.08
147 0.08
148 0.07
149 0.05
150 0.04
151 0.04
152 0.04
153 0.05
154 0.06
155 0.06
156 0.07
157 0.08
158 0.12
159 0.13
160 0.19
161 0.2
162 0.2
163 0.2
164 0.24
165 0.25
166 0.22
167 0.22
168 0.18
169 0.16
170 0.16
171 0.16
172 0.11
173 0.1
174 0.12
175 0.12
176 0.11
177 0.11
178 0.12
179 0.13
180 0.18
181 0.23
182 0.2
183 0.2
184 0.21
185 0.22
186 0.24
187 0.24
188 0.22
189 0.18
190 0.2
191 0.19
192 0.17
193 0.16
194 0.16
195 0.15
196 0.15
197 0.14
198 0.11
199 0.12
200 0.12
201 0.12
202 0.09
203 0.08
204 0.06
205 0.05
206 0.05
207 0.05
208 0.04
209 0.04
210 0.04
211 0.05
212 0.05
213 0.05
214 0.06
215 0.08
216 0.09
217 0.09
218 0.1
219 0.11
220 0.12
221 0.12
222 0.17
223 0.15
224 0.14
225 0.14
226 0.15
227 0.14
228 0.13
229 0.13
230 0.07
231 0.07
232 0.07
233 0.08
234 0.07
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.11
241 0.11
242 0.13
243 0.14
244 0.15
245 0.18
246 0.19
247 0.2
248 0.18
249 0.18
250 0.17
251 0.16
252 0.15
253 0.12
254 0.1
255 0.1
256 0.08
257 0.07
258 0.07
259 0.06
260 0.06
261 0.06
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.07
272 0.07
273 0.07
274 0.07
275 0.08
276 0.1
277 0.13
278 0.14
279 0.15
280 0.16
281 0.16
282 0.15
283 0.14
284 0.14
285 0.13
286 0.12
287 0.1
288 0.08
289 0.08
290 0.09
291 0.07
292 0.06
293 0.03
294 0.03
295 0.04
296 0.04
297 0.04
298 0.06
299 0.08
300 0.08
301 0.09
302 0.11
303 0.12
304 0.15
305 0.19
306 0.2
307 0.22
308 0.23
309 0.23
310 0.22
311 0.2
312 0.17
313 0.13
314 0.1
315 0.06
316 0.06
317 0.06
318 0.07
319 0.07
320 0.07
321 0.07
322 0.07
323 0.08
324 0.07
325 0.06
326 0.04
327 0.04
328 0.05
329 0.04
330 0.04
331 0.03
332 0.03
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.04
339 0.04
340 0.04
341 0.04
342 0.04
343 0.04
344 0.04
345 0.03
346 0.04
347 0.03
348 0.03
349 0.03
350 0.04
351 0.05
352 0.07
353 0.07
354 0.08
355 0.08
356 0.09
357 0.11
358 0.12
359 0.16
360 0.19
361 0.2
362 0.19
363 0.2
364 0.2
365 0.19
366 0.17
367 0.12
368 0.07
369 0.06
370 0.06
371 0.06
372 0.08
373 0.08
374 0.09
375 0.09
376 0.12
377 0.13
378 0.12
379 0.15
380 0.13
381 0.17
382 0.16
383 0.17
384 0.16
385 0.16
386 0.18
387 0.15
388 0.16
389 0.14
390 0.14
391 0.15
392 0.15
393 0.15
394 0.15
395 0.15
396 0.14
397 0.12
398 0.14
399 0.16
400 0.16
401 0.2
402 0.22
403 0.27
404 0.3
405 0.3
406 0.3
407 0.3
408 0.29
409 0.26
410 0.28
411 0.25
412 0.22
413 0.22
414 0.2
415 0.19
416 0.2
417 0.19
418 0.16
419 0.12
420 0.15
421 0.16
422 0.18
423 0.17
424 0.15
425 0.15
426 0.14
427 0.16
428 0.13
429 0.12
430 0.1
431 0.1
432 0.1
433 0.1
434 0.1
435 0.1
436 0.14
437 0.18
438 0.21
439 0.23
440 0.25
441 0.26
442 0.3
443 0.31
444 0.3
445 0.32
446 0.39
447 0.42
448 0.45
449 0.48
450 0.44
451 0.41
452 0.39
453 0.36
454 0.28
455 0.25
456 0.19
457 0.19
458 0.2
459 0.19
460 0.18
461 0.15
462 0.12
463 0.1
464 0.09
465 0.05
466 0.05
467 0.1
468 0.13
469 0.14
470 0.17
471 0.22
472 0.27
473 0.36
474 0.41
475 0.4
476 0.41
477 0.47
478 0.47
479 0.44
480 0.4
481 0.31
482 0.25
483 0.21
484 0.19
485 0.13
486 0.12
487 0.1
488 0.12
489 0.19
490 0.28
491 0.35
492 0.42
493 0.5
494 0.53
495 0.62
496 0.64
497 0.63
498 0.61
499 0.57
500 0.57
501 0.58
502 0.58
503 0.58
504 0.61
505 0.59
506 0.56
507 0.61
508 0.58
509 0.54
510 0.55
511 0.51
512 0.5
513 0.47
514 0.43
515 0.36
516 0.31
517 0.26
518 0.2
519 0.14
520 0.08
521 0.07
522 0.1
523 0.12
524 0.12
525 0.13
526 0.16
527 0.21
528 0.29
529 0.39
530 0.45
531 0.52
532 0.61
533 0.68
534 0.75
535 0.79
536 0.81
537 0.81
538 0.81
539 0.84
540 0.84
541 0.88
542 0.88
543 0.88
544 0.89
545 0.86
546 0.86