Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZNB8

Protein Details
Accession G8ZNB8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
48-72KYQKALYQGKKKKPQPKVQNPVKVEHydrophilic
NLS Segment(s)
PositionSequence
56-92GKKKKPQPKVQNPVKVEKPSKDEKPSKVEKPKIEKAK
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
KEGG tdl:TDEL_0A07800  -  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPPFQRKITEKHYSRCPEAYYTCIDCSKTFDDGYSYQKHTQCITEDEKYQKALYQGKKKKPQPKVQNPVKVEKPSKDEKPSKVEKPKIEKAKSNDGFPKFEAGSSLYKMLKTVRDKETKKTLLKSLVCNSEGHWVLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.59
4 0.54
5 0.5
6 0.46
7 0.41
8 0.38
9 0.36
10 0.34
11 0.33
12 0.27
13 0.29
14 0.29
15 0.26
16 0.23
17 0.21
18 0.22
19 0.23
20 0.28
21 0.28
22 0.29
23 0.33
24 0.35
25 0.36
26 0.34
27 0.34
28 0.31
29 0.31
30 0.32
31 0.29
32 0.31
33 0.33
34 0.33
35 0.32
36 0.3
37 0.26
38 0.25
39 0.3
40 0.34
41 0.41
42 0.48
43 0.56
44 0.66
45 0.72
46 0.77
47 0.79
48 0.81
49 0.82
50 0.84
51 0.85
52 0.84
53 0.85
54 0.78
55 0.74
56 0.69
57 0.64
58 0.55
59 0.48
60 0.44
61 0.42
62 0.44
63 0.48
64 0.49
65 0.47
66 0.52
67 0.56
68 0.6
69 0.63
70 0.64
71 0.63
72 0.66
73 0.7
74 0.72
75 0.7
76 0.68
77 0.64
78 0.68
79 0.63
80 0.6
81 0.58
82 0.52
83 0.5
84 0.44
85 0.42
86 0.31
87 0.29
88 0.25
89 0.2
90 0.19
91 0.19
92 0.22
93 0.18
94 0.18
95 0.19
96 0.21
97 0.26
98 0.29
99 0.35
100 0.4
101 0.49
102 0.52
103 0.59
104 0.67
105 0.67
106 0.68
107 0.66
108 0.64
109 0.63
110 0.65
111 0.65
112 0.62
113 0.61
114 0.55
115 0.5
116 0.45
117 0.44