Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CP69

Protein Details
Accession A0A0K3CP69    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
343-387RSRSSAGKEKLRPPPRTRRGPSAKEKKELARQRRMERRRAKGIGABasic
NLS Segment(s)
PositionSequence
10-28RSKGKGVQKTYGKGRDRTR
341-385KVRSRSSAGKEKLRPPPRTRRGPSAKEKKELARQRRMERRRAKGI
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22756  OTU_OTUD3-like  
Amino Acid Sequences MAKGARHELRSKGKGVQKTYGKGRDRTRADKPKLIENPELEEQVLRNQLREAGLYAANVLGGAFAMETVSFGEETLGLCGEAFASSHDLSTSSRSALSDQLYGSPSMHLAIRQEVCDYLSSHPDRFRLFVDEDSVPGGFEGHVRSMRQPGTYGTNIELSAFVARYRRPVKIWQPNLIYVMPVEEGSADSTSSNPEGSSGKEKVYHSWEHYSSLRNLTGPHTGPPRLRVDRVGSARPEERRTASKEPDAEAEEPVDEDEPMEDEPPSQPPSPPAQAPPGRLRPPDRQAATVASSIRDRSMSPFPPSQGGKTGYAVTEESPLHDEFHQGEEGETDSSDAHRDKVRSRSSAGKEKLRPPPRTRRGPSAKEKKELARQRRMERRRAKGIGASGGVAGGGSSDRVLRSAGPASDAGLAKVRELYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.64
4 0.62
5 0.65
6 0.71
7 0.72
8 0.71
9 0.72
10 0.74
11 0.75
12 0.75
13 0.74
14 0.76
15 0.77
16 0.77
17 0.76
18 0.71
19 0.72
20 0.71
21 0.7
22 0.66
23 0.57
24 0.56
25 0.52
26 0.5
27 0.4
28 0.34
29 0.28
30 0.27
31 0.32
32 0.25
33 0.23
34 0.23
35 0.26
36 0.25
37 0.25
38 0.22
39 0.17
40 0.18
41 0.17
42 0.16
43 0.13
44 0.11
45 0.1
46 0.08
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.09
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.15
78 0.16
79 0.13
80 0.14
81 0.14
82 0.15
83 0.18
84 0.19
85 0.18
86 0.17
87 0.19
88 0.19
89 0.19
90 0.18
91 0.14
92 0.12
93 0.11
94 0.11
95 0.1
96 0.1
97 0.15
98 0.16
99 0.16
100 0.17
101 0.16
102 0.17
103 0.17
104 0.18
105 0.14
106 0.2
107 0.22
108 0.24
109 0.26
110 0.28
111 0.28
112 0.28
113 0.27
114 0.24
115 0.24
116 0.22
117 0.24
118 0.21
119 0.2
120 0.2
121 0.18
122 0.13
123 0.11
124 0.1
125 0.06
126 0.07
127 0.08
128 0.09
129 0.11
130 0.12
131 0.14
132 0.19
133 0.2
134 0.2
135 0.2
136 0.19
137 0.23
138 0.23
139 0.23
140 0.19
141 0.19
142 0.18
143 0.17
144 0.15
145 0.1
146 0.1
147 0.09
148 0.08
149 0.09
150 0.1
151 0.17
152 0.2
153 0.22
154 0.23
155 0.31
156 0.41
157 0.49
158 0.54
159 0.53
160 0.53
161 0.52
162 0.52
163 0.44
164 0.34
165 0.23
166 0.19
167 0.12
168 0.09
169 0.08
170 0.05
171 0.05
172 0.06
173 0.06
174 0.05
175 0.05
176 0.05
177 0.06
178 0.07
179 0.06
180 0.05
181 0.06
182 0.07
183 0.09
184 0.14
185 0.14
186 0.15
187 0.19
188 0.2
189 0.22
190 0.26
191 0.27
192 0.25
193 0.28
194 0.28
195 0.27
196 0.28
197 0.28
198 0.25
199 0.25
200 0.22
201 0.17
202 0.18
203 0.17
204 0.2
205 0.17
206 0.19
207 0.19
208 0.22
209 0.22
210 0.25
211 0.3
212 0.29
213 0.29
214 0.29
215 0.3
216 0.34
217 0.37
218 0.37
219 0.3
220 0.31
221 0.34
222 0.34
223 0.33
224 0.29
225 0.28
226 0.29
227 0.34
228 0.38
229 0.37
230 0.38
231 0.37
232 0.36
233 0.36
234 0.34
235 0.28
236 0.23
237 0.19
238 0.15
239 0.13
240 0.12
241 0.1
242 0.06
243 0.05
244 0.05
245 0.05
246 0.05
247 0.06
248 0.06
249 0.06
250 0.07
251 0.1
252 0.14
253 0.13
254 0.14
255 0.17
256 0.22
257 0.24
258 0.25
259 0.25
260 0.3
261 0.33
262 0.37
263 0.41
264 0.44
265 0.45
266 0.48
267 0.51
268 0.51
269 0.53
270 0.57
271 0.51
272 0.45
273 0.42
274 0.41
275 0.38
276 0.32
277 0.27
278 0.2
279 0.19
280 0.18
281 0.17
282 0.15
283 0.13
284 0.15
285 0.22
286 0.25
287 0.28
288 0.31
289 0.31
290 0.36
291 0.37
292 0.34
293 0.33
294 0.32
295 0.29
296 0.28
297 0.28
298 0.22
299 0.22
300 0.21
301 0.16
302 0.17
303 0.15
304 0.15
305 0.16
306 0.16
307 0.17
308 0.16
309 0.17
310 0.15
311 0.17
312 0.17
313 0.14
314 0.14
315 0.12
316 0.13
317 0.12
318 0.1
319 0.08
320 0.07
321 0.08
322 0.11
323 0.11
324 0.13
325 0.18
326 0.21
327 0.26
328 0.35
329 0.42
330 0.42
331 0.45
332 0.52
333 0.55
334 0.63
335 0.64
336 0.64
337 0.65
338 0.7
339 0.77
340 0.76
341 0.78
342 0.77
343 0.81
344 0.82
345 0.85
346 0.83
347 0.83
348 0.84
349 0.85
350 0.87
351 0.87
352 0.84
353 0.8
354 0.8
355 0.77
356 0.77
357 0.77
358 0.76
359 0.76
360 0.77
361 0.8
362 0.85
363 0.86
364 0.86
365 0.86
366 0.85
367 0.85
368 0.8
369 0.74
370 0.7
371 0.66
372 0.61
373 0.52
374 0.43
375 0.33
376 0.28
377 0.23
378 0.17
379 0.11
380 0.06
381 0.05
382 0.04
383 0.05
384 0.07
385 0.07
386 0.08
387 0.1
388 0.1
389 0.14
390 0.19
391 0.19
392 0.2
393 0.2
394 0.21
395 0.26
396 0.25
397 0.22
398 0.23
399 0.23
400 0.21