Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CW90

Protein Details
Accession A0A0K3CW90   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-99AYRILLRYDRKSRHRRIKKQPSNSEGLKHydrophilic
NLS Segment(s)
PositionSequence
81-92RKSRHRRIKKQP
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MVYEPKLYLYSTKICGTNIIVSSTDSGLEAFSHNPTRGSFAALPDRTAANTNYANQRFLSSRSLLVGEQSNAYRILLRYDRKSRHRRIKKQPSNSEGLKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.28
5 0.25
6 0.23
7 0.2
8 0.19
9 0.2
10 0.18
11 0.16
12 0.1
13 0.09
14 0.07
15 0.07
16 0.08
17 0.07
18 0.1
19 0.13
20 0.13
21 0.14
22 0.14
23 0.18
24 0.17
25 0.2
26 0.18
27 0.19
28 0.26
29 0.25
30 0.26
31 0.22
32 0.22
33 0.18
34 0.19
35 0.17
36 0.12
37 0.13
38 0.14
39 0.21
40 0.21
41 0.22
42 0.2
43 0.21
44 0.19
45 0.21
46 0.22
47 0.16
48 0.16
49 0.16
50 0.17
51 0.15
52 0.16
53 0.15
54 0.12
55 0.13
56 0.13
57 0.13
58 0.12
59 0.12
60 0.13
61 0.11
62 0.16
63 0.21
64 0.26
65 0.33
66 0.42
67 0.51
68 0.59
69 0.69
70 0.74
71 0.79
72 0.85
73 0.88
74 0.9
75 0.93
76 0.94
77 0.94
78 0.94
79 0.89
80 0.86
81 0.79