Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CNU9

Protein Details
Accession A0A0K3CNU9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-49ERLKQNAERLQKQRRKYEAFHydrophilic
NLS Segment(s)
PositionSequence
277-293RRRAEAKRVQREAQGKA
300-330MPWRRRGARPPGSAEPAKEKTVEEKREGAGK
Subcellular Location(s) mito 9, plas 9, E.R. 3, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019168  NEP1-R1  
IPR005605  Spo7  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0071595  C:Nem1-Spo7 phosphatase complex  
GO:0031965  C:nuclear membrane  
GO:0019888  F:protein phosphatase regulator activity  
GO:0006629  P:lipid metabolic process  
GO:0035307  P:positive regulation of protein dephosphorylation  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MSPALVSRRARTFHPPATRESFKDLLIFEERLKQNAERLQKQRRKYEAFLFSLVAVIVYLGYGVFVLPSIYSLVHYSNIAMLLVAVTTLVLFFATGMYSEKIAYAHKFVPQANRALRPFNIYLNTRHRSRFSLFRLFKSSPSPALSRTPSGRSLTPSSALSSPPLSRRTSASSAASSTDTVRSTGAFRSPPPSPPLAANASPPPSPSRRTLPLPETIDDGPVTRAPPSPPPSSSPRSGVPIPPIPPAQNLRGELIFSSRVNPQFREGYERYRAEWERRRAEAKRVQREAQGKAGWMGWMMPWRRRGARPPGSAEPAKEKTVEEKREGAGKAPPSLPKFEQGGDADSFGGSFPPTRSSSPDPHGEHTSTVLSSTSTPASSLSRSSSPSRLAAEGGRSSPVRIRAESFSELLTHSLDEEGEGAKGRTQFTRGPGLERSGSMRASGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.6
4 0.66
5 0.68
6 0.61
7 0.59
8 0.52
9 0.43
10 0.44
11 0.37
12 0.33
13 0.32
14 0.31
15 0.25
16 0.33
17 0.33
18 0.32
19 0.35
20 0.31
21 0.34
22 0.39
23 0.47
24 0.47
25 0.55
26 0.64
27 0.68
28 0.75
29 0.78
30 0.81
31 0.79
32 0.76
33 0.76
34 0.74
35 0.7
36 0.64
37 0.55
38 0.45
39 0.38
40 0.31
41 0.21
42 0.12
43 0.08
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.03
55 0.04
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.1
62 0.11
63 0.1
64 0.11
65 0.11
66 0.1
67 0.08
68 0.07
69 0.06
70 0.05
71 0.05
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.03
80 0.03
81 0.03
82 0.04
83 0.06
84 0.07
85 0.08
86 0.08
87 0.09
88 0.1
89 0.12
90 0.13
91 0.15
92 0.16
93 0.2
94 0.24
95 0.26
96 0.33
97 0.34
98 0.4
99 0.41
100 0.46
101 0.44
102 0.44
103 0.42
104 0.39
105 0.37
106 0.33
107 0.34
108 0.29
109 0.34
110 0.4
111 0.43
112 0.41
113 0.43
114 0.41
115 0.41
116 0.43
117 0.45
118 0.43
119 0.5
120 0.49
121 0.5
122 0.55
123 0.51
124 0.5
125 0.46
126 0.42
127 0.34
128 0.35
129 0.32
130 0.28
131 0.32
132 0.33
133 0.31
134 0.32
135 0.31
136 0.32
137 0.33
138 0.32
139 0.31
140 0.32
141 0.3
142 0.29
143 0.26
144 0.25
145 0.23
146 0.22
147 0.19
148 0.17
149 0.17
150 0.2
151 0.23
152 0.22
153 0.22
154 0.24
155 0.29
156 0.3
157 0.31
158 0.28
159 0.26
160 0.25
161 0.25
162 0.23
163 0.17
164 0.15
165 0.14
166 0.13
167 0.12
168 0.11
169 0.11
170 0.11
171 0.12
172 0.14
173 0.13
174 0.14
175 0.17
176 0.18
177 0.2
178 0.22
179 0.22
180 0.2
181 0.2
182 0.23
183 0.22
184 0.22
185 0.21
186 0.2
187 0.21
188 0.2
189 0.2
190 0.2
191 0.19
192 0.21
193 0.22
194 0.25
195 0.27
196 0.31
197 0.35
198 0.35
199 0.39
200 0.39
201 0.36
202 0.34
203 0.29
204 0.26
205 0.21
206 0.19
207 0.12
208 0.11
209 0.1
210 0.09
211 0.1
212 0.11
213 0.17
214 0.21
215 0.23
216 0.24
217 0.27
218 0.32
219 0.35
220 0.36
221 0.32
222 0.29
223 0.3
224 0.3
225 0.28
226 0.27
227 0.27
228 0.27
229 0.26
230 0.26
231 0.22
232 0.24
233 0.25
234 0.23
235 0.23
236 0.22
237 0.21
238 0.2
239 0.2
240 0.16
241 0.16
242 0.15
243 0.11
244 0.12
245 0.14
246 0.19
247 0.21
248 0.22
249 0.23
250 0.25
251 0.25
252 0.32
253 0.3
254 0.31
255 0.36
256 0.36
257 0.35
258 0.39
259 0.41
260 0.41
261 0.48
262 0.51
263 0.49
264 0.51
265 0.56
266 0.52
267 0.58
268 0.58
269 0.59
270 0.61
271 0.61
272 0.59
273 0.6
274 0.62
275 0.56
276 0.54
277 0.45
278 0.35
279 0.31
280 0.29
281 0.22
282 0.17
283 0.14
284 0.09
285 0.14
286 0.16
287 0.19
288 0.23
289 0.27
290 0.32
291 0.36
292 0.42
293 0.47
294 0.55
295 0.56
296 0.59
297 0.59
298 0.61
299 0.59
300 0.53
301 0.5
302 0.44
303 0.39
304 0.34
305 0.29
306 0.32
307 0.39
308 0.42
309 0.37
310 0.37
311 0.37
312 0.43
313 0.43
314 0.36
315 0.32
316 0.3
317 0.31
318 0.3
319 0.35
320 0.31
321 0.36
322 0.35
323 0.34
324 0.33
325 0.3
326 0.32
327 0.27
328 0.29
329 0.24
330 0.23
331 0.19
332 0.17
333 0.16
334 0.11
335 0.1
336 0.06
337 0.07
338 0.08
339 0.12
340 0.15
341 0.17
342 0.23
343 0.29
344 0.35
345 0.38
346 0.46
347 0.45
348 0.47
349 0.5
350 0.45
351 0.4
352 0.36
353 0.33
354 0.24
355 0.21
356 0.16
357 0.12
358 0.12
359 0.14
360 0.13
361 0.11
362 0.11
363 0.13
364 0.15
365 0.16
366 0.17
367 0.19
368 0.2
369 0.24
370 0.28
371 0.31
372 0.32
373 0.34
374 0.34
375 0.31
376 0.3
377 0.29
378 0.31
379 0.29
380 0.27
381 0.27
382 0.25
383 0.26
384 0.28
385 0.33
386 0.32
387 0.31
388 0.34
389 0.34
390 0.4
391 0.41
392 0.37
393 0.3
394 0.27
395 0.26
396 0.23
397 0.19
398 0.14
399 0.11
400 0.11
401 0.1
402 0.09
403 0.09
404 0.09
405 0.09
406 0.1
407 0.1
408 0.13
409 0.16
410 0.18
411 0.2
412 0.23
413 0.27
414 0.3
415 0.4
416 0.38
417 0.4
418 0.42
419 0.45
420 0.43
421 0.4
422 0.41
423 0.34
424 0.33