FuNGI

A0A0K3CB94

Protein Details

Accession

A0A0K3CB94

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
56-82	ATLNQVTRGCRKPKKRGVKTPALQGCY	Hydrophilic
84-110	KKGVCSKVYTVKPKKPNSAVRKVAKVK	Hydrophilic

NLS Segment(s)

Position	Sequence
68-71	PKKR

Subcellular Location(s)

mito 20, extr 3, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR026992 DIOX_N IPR044861 IPNS-like_FE2OG_OXY IPR027443 IPNS-like_sf IPR012340 NA-bd_OB-fold IPR005123 Oxoglu/Fe-dep_dioxygenase IPR006032 Ribosomal_S12/S23 IPR005679 Ribosomal_S12_bac
Gene Ontology	GO:0015935 C:small ribosomal subunit GO:0003735 F:structural constituent of ribosome GO:1901362 P:organic cyclic compound biosynthetic process GO:0044283 P:small molecule biosynthetic process GO:0006412 P:translation
Pfam	View protein in Pfam PF03171 2OG-FeII_Oxy PF14226 DIOX_N PF00164 Ribosom_S12_S23
PROSITE	View protein in PROSITE PS51471 FE2OG_OXY PS00055 RIBOSOMAL_S12
CDD	cd03368 Ribosomal_S12

Amino Acid Sequences

MFSLAASFARLTIAARPALARPSLRSAVAASSSSPLASTSRVQLQHAFSTSRPAQATLNQVTRGCRKPKKRGVKTPALQGCYQKKGVCSKVYTVKPKKPNSAVRKVAKVKLSTGRSIIAYIPGEGHNLQEHSVVLIRGGRTQDLPGAKYKIVRGAQDLSGVVGRASSRSKYGGAQEAEEVDPPHPAIHPLCLRSDPFPPPSTQGGATMLLVLRRFTRLLWSRYSAAVPLTHCAQLNSASSSPSPSIARMSLPILSYATARTDPSAFIQQLQHALLTTGFFYLSDIDSVLPEWKSAWDDAFSASASFFAQPVEVKQEIGMIKSRHFRGYSAYGVEVTQGKRDLREQIDFGPEMADAARPRSDDEPLELSLYGPNQYPASTPALEPAIQRWRDLNDSIARDLVSLLAQSLTPDPERIVDIFIPSSAADYPAYSRMKVVQYPPIKPGEEGAGVGSHKDGGGITLLAQDQTGGLQVQTWEGEWIGVEPVPYALVINVGQVIERMSSGLYAATTHRVLATTGPSPRLSIPFFYSPKLTSTLHRLSLTEIHPSLLALAAQTEGKEKVSDVKKGDLHEEVFGRAAWRGITRSHVDVWERWYGRERDPVGGPERV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.18
3	0.2
4	0.21
5	0.25
6	0.28
7	0.26
8	0.26
9	0.32
10	0.34
11	0.33
12	0.32
13	0.29
14	0.29
15	0.29
16	0.26
17	0.19
18	0.18
19	0.18
20	0.17
21	0.15
22	0.13
23	0.12
24	0.14
25	0.15
26	0.18
27	0.25
28	0.27
29	0.29
30	0.34
31	0.37
32	0.39
33	0.4
34	0.38
35	0.3
36	0.37
37	0.37
38	0.37
39	0.34
40	0.3
41	0.29
42	0.32
43	0.4
44	0.38
45	0.41
46	0.38
47	0.39
48	0.43
49	0.48
50	0.52
51	0.54
52	0.57
53	0.62
54	0.7
55	0.79
56	0.85
57	0.88
58	0.91
59	0.91
60	0.92
61	0.88
62	0.87
63	0.84
64	0.76
65	0.68
66	0.66
67	0.63
68	0.58
69	0.56
70	0.48
71	0.45
72	0.5
73	0.53
74	0.51
75	0.48
76	0.49
77	0.54
78	0.6
79	0.66
80	0.67
81	0.7
82	0.74
83	0.78
84	0.8
85	0.8
86	0.82
87	0.81
88	0.82
89	0.82
90	0.79
91	0.82
92	0.79
93	0.75
94	0.71
95	0.63
96	0.59
97	0.58
98	0.56
99	0.49
100	0.44
101	0.4
102	0.35
103	0.34
104	0.28
105	0.23
106	0.2
107	0.17
108	0.17
109	0.15
110	0.17
111	0.15
112	0.16
113	0.14
114	0.14
115	0.14
116	0.13
117	0.13
118	0.11
119	0.13
120	0.12
121	0.1
122	0.12
123	0.12
124	0.15
125	0.16
126	0.16
127	0.15
128	0.16
129	0.2
130	0.2
131	0.21
132	0.23
133	0.26
134	0.26
135	0.27
136	0.28
137	0.31
138	0.31
139	0.31
140	0.3
141	0.3
142	0.3
143	0.29
144	0.27
145	0.2
146	0.18
147	0.16
148	0.12
149	0.09
150	0.08
151	0.09
152	0.11
153	0.11
154	0.13
155	0.14
156	0.16
157	0.18
158	0.22
159	0.27
160	0.26
161	0.26
162	0.24
163	0.25
164	0.24
165	0.22
166	0.19
167	0.12
168	0.12
169	0.11
170	0.1
171	0.08
172	0.1
173	0.1
174	0.15
175	0.18
176	0.19
177	0.21
178	0.22
179	0.24
180	0.24
181	0.28
182	0.26
183	0.27
184	0.27
185	0.27
186	0.29
187	0.3
188	0.29
189	0.25
190	0.22
191	0.19
192	0.18
193	0.17
194	0.14
195	0.12
196	0.11
197	0.11
198	0.1
199	0.09
200	0.1
201	0.1
202	0.09
203	0.18
204	0.24
205	0.27
206	0.3
207	0.33
208	0.33
209	0.34
210	0.34
211	0.26
212	0.2
213	0.19
214	0.16
215	0.14
216	0.14
217	0.15
218	0.14
219	0.14
220	0.14
221	0.14
222	0.14
223	0.16
224	0.14
225	0.13
226	0.13
227	0.15
228	0.14
229	0.14
230	0.13
231	0.11
232	0.12
233	0.12
234	0.12
235	0.12
236	0.12
237	0.12
238	0.12
239	0.12
240	0.1
241	0.1
242	0.1
243	0.09
244	0.1
245	0.09
246	0.08
247	0.09
248	0.09
249	0.09
250	0.11
251	0.15
252	0.14
253	0.15
254	0.15
255	0.15
256	0.17
257	0.16
258	0.14
259	0.09
260	0.1
261	0.08
262	0.07
263	0.07
264	0.05
265	0.05
266	0.04
267	0.05
268	0.05
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.06
275	0.07
276	0.06
277	0.06
278	0.06
279	0.07
280	0.08
281	0.08
282	0.08
283	0.07
284	0.07
285	0.08
286	0.08
287	0.08
288	0.07
289	0.06
290	0.06
291	0.06
292	0.06
293	0.05
294	0.04
295	0.05
296	0.05
297	0.06
298	0.1
299	0.1
300	0.1
301	0.09
302	0.13
303	0.13
304	0.14
305	0.18
306	0.14
307	0.17
308	0.22
309	0.24
310	0.23
311	0.23
312	0.23
313	0.23
314	0.26
315	0.25
316	0.21
317	0.2
318	0.17
319	0.17
320	0.18
321	0.16
322	0.12
323	0.12
324	0.13
325	0.13
326	0.14
327	0.16
328	0.21
329	0.21
330	0.23
331	0.22
332	0.22
333	0.24
334	0.23
335	0.21
336	0.16
337	0.13
338	0.11
339	0.1
340	0.09
341	0.07
342	0.08
343	0.1
344	0.09
345	0.12
346	0.13
347	0.14
348	0.13
349	0.16
350	0.17
351	0.16
352	0.17
353	0.15
354	0.14
355	0.13
356	0.13
357	0.11
358	0.08
359	0.09
360	0.08
361	0.08
362	0.09
363	0.1
364	0.13
365	0.13
366	0.13
367	0.14
368	0.15
369	0.16
370	0.15
371	0.17
372	0.22
373	0.22
374	0.23
375	0.22
376	0.23
377	0.25
378	0.26
379	0.26
380	0.23
381	0.25
382	0.25
383	0.24
384	0.22
385	0.19
386	0.18
387	0.14
388	0.08
389	0.06
390	0.06
391	0.05
392	0.05
393	0.06
394	0.07
395	0.08
396	0.08
397	0.09
398	0.09
399	0.1
400	0.11
401	0.11
402	0.12
403	0.11
404	0.11
405	0.11
406	0.11
407	0.1
408	0.09
409	0.1
410	0.08
411	0.08
412	0.07
413	0.08
414	0.09
415	0.16
416	0.17
417	0.16
418	0.17
419	0.2
420	0.23
421	0.26
422	0.27
423	0.3
424	0.34
425	0.37
426	0.4
427	0.4
428	0.37
429	0.34
430	0.32
431	0.27
432	0.22
433	0.2
434	0.16
435	0.14
436	0.13
437	0.13
438	0.12
439	0.08
440	0.07
441	0.07
442	0.06
443	0.05
444	0.06
445	0.06
446	0.06
447	0.08
448	0.08
449	0.08
450	0.08
451	0.07
452	0.06
453	0.06
454	0.07
455	0.05
456	0.05
457	0.06
458	0.06
459	0.07
460	0.08
461	0.08
462	0.07
463	0.07
464	0.07
465	0.06
466	0.07
467	0.07
468	0.07
469	0.07
470	0.06
471	0.06
472	0.07
473	0.07
474	0.06
475	0.05
476	0.06
477	0.06
478	0.06
479	0.07
480	0.07
481	0.07
482	0.07
483	0.08
484	0.06
485	0.06
486	0.06
487	0.06
488	0.06
489	0.06
490	0.06
491	0.06
492	0.06
493	0.08
494	0.12
495	0.12
496	0.12
497	0.12
498	0.13
499	0.13
500	0.14
501	0.17
502	0.18
503	0.21
504	0.24
505	0.24
506	0.25
507	0.27
508	0.29
509	0.27
510	0.25
511	0.28
512	0.33
513	0.35
514	0.35
515	0.36
516	0.32
517	0.33
518	0.34
519	0.3
520	0.25
521	0.32
522	0.36
523	0.38
524	0.38
525	0.36
526	0.35
527	0.41
528	0.39
529	0.37
530	0.31
531	0.27
532	0.25
533	0.25
534	0.22
535	0.16
536	0.14
537	0.07
538	0.07
539	0.07
540	0.08
541	0.08
542	0.11
543	0.11
544	0.12
545	0.13
546	0.13
547	0.21
548	0.26
549	0.33
550	0.33
551	0.4
552	0.42
553	0.44
554	0.48
555	0.43
556	0.39
557	0.37
558	0.35
559	0.29
560	0.27
561	0.25
562	0.22
563	0.17
564	0.17
565	0.14
566	0.15
567	0.16
568	0.17
569	0.23
570	0.26
571	0.29
572	0.31
573	0.34
574	0.36
575	0.37
576	0.4
577	0.43
578	0.41
579	0.39
580	0.45
581	0.44
582	0.45
583	0.51
584	0.49
585	0.45
586	0.48
587	0.52

A0A0K3CB94

3D AlphaFold-predicted Structure Viewer