Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AMP7

Protein Details
Accession G3AMP7   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
218-237LKNGNLSKRFGRRNTPKQTPHydrophilic
NLS Segment(s)
PositionSequence
43-51AIKKSKAKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
KEGG spaa:SPAPADRAFT_60843  -  
Amino Acid Sequences MQQENLQLKSNIYANKVNNPTFIPSSGLLEENSKSAIKISDKAIKKSKAKKDASGVRLNYKIEAKYEEEEQSLSQKNIKIKLPNIFRDTPESDYFLKDMISSQEANRYGEDYCSTFYKRNIHGYMFIKEPSNSLKVNASGGKSSVSLKISLPAGNNRLLAKKLKVDVKELPIWKPISSGNGGTASFTARRRPNVNSNNTSNGTKETKGIQATQDPPKLKNGNLSKRFGRRNTPKQTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.48
4 0.46
5 0.43
6 0.42
7 0.43
8 0.38
9 0.36
10 0.3
11 0.24
12 0.26
13 0.25
14 0.24
15 0.19
16 0.19
17 0.19
18 0.16
19 0.18
20 0.14
21 0.13
22 0.13
23 0.17
24 0.17
25 0.2
26 0.25
27 0.32
28 0.36
29 0.43
30 0.51
31 0.54
32 0.6
33 0.67
34 0.72
35 0.73
36 0.74
37 0.73
38 0.74
39 0.75
40 0.73
41 0.72
42 0.65
43 0.6
44 0.59
45 0.53
46 0.46
47 0.4
48 0.34
49 0.27
50 0.28
51 0.25
52 0.23
53 0.25
54 0.24
55 0.21
56 0.21
57 0.19
58 0.21
59 0.2
60 0.19
61 0.19
62 0.21
63 0.24
64 0.28
65 0.32
66 0.32
67 0.34
68 0.42
69 0.45
70 0.48
71 0.5
72 0.47
73 0.44
74 0.45
75 0.44
76 0.4
77 0.34
78 0.31
79 0.26
80 0.25
81 0.24
82 0.18
83 0.15
84 0.11
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.15
91 0.16
92 0.17
93 0.17
94 0.16
95 0.14
96 0.14
97 0.15
98 0.1
99 0.1
100 0.11
101 0.13
102 0.14
103 0.16
104 0.22
105 0.23
106 0.29
107 0.3
108 0.28
109 0.33
110 0.33
111 0.33
112 0.28
113 0.26
114 0.21
115 0.19
116 0.2
117 0.16
118 0.16
119 0.15
120 0.14
121 0.15
122 0.14
123 0.17
124 0.18
125 0.16
126 0.13
127 0.14
128 0.13
129 0.12
130 0.13
131 0.14
132 0.13
133 0.13
134 0.13
135 0.15
136 0.15
137 0.16
138 0.17
139 0.18
140 0.19
141 0.2
142 0.22
143 0.2
144 0.21
145 0.22
146 0.23
147 0.22
148 0.24
149 0.27
150 0.31
151 0.31
152 0.34
153 0.37
154 0.39
155 0.43
156 0.41
157 0.38
158 0.38
159 0.38
160 0.33
161 0.29
162 0.25
163 0.22
164 0.22
165 0.21
166 0.18
167 0.19
168 0.19
169 0.18
170 0.17
171 0.15
172 0.17
173 0.18
174 0.24
175 0.26
176 0.31
177 0.35
178 0.41
179 0.5
180 0.56
181 0.64
182 0.63
183 0.63
184 0.64
185 0.64
186 0.58
187 0.49
188 0.44
189 0.39
190 0.32
191 0.3
192 0.26
193 0.28
194 0.3
195 0.31
196 0.3
197 0.33
198 0.39
199 0.45
200 0.49
201 0.46
202 0.45
203 0.52
204 0.52
205 0.46
206 0.49
207 0.51
208 0.55
209 0.6
210 0.65
211 0.64
212 0.7
213 0.78
214 0.74
215 0.75
216 0.75
217 0.78