Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CLN2

Protein Details
Accession A0A0K3CLN2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-117GLAEKRERTGRKLRKERKSKKKBasic
NLS Segment(s)
PositionSequence
99-117EKRERTGRKLRKERKSKKK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPNGAVTIRTRKFITNRLLQRKQMVVDVLHPTRPNVSKDELRDKLAAMYKAPKDQVIVFGFRTQFGGGKSTGFALIYDSKESLKFEPRYRLVRFGLAEKRERTGRKLRKERKSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.5
4 0.58
5 0.65
6 0.7
7 0.67
8 0.67
9 0.63
10 0.56
11 0.49
12 0.41
13 0.31
14 0.3
15 0.33
16 0.29
17 0.29
18 0.27
19 0.25
20 0.28
21 0.3
22 0.28
23 0.24
24 0.28
25 0.3
26 0.35
27 0.44
28 0.41
29 0.4
30 0.38
31 0.35
32 0.34
33 0.33
34 0.29
35 0.2
36 0.24
37 0.23
38 0.25
39 0.25
40 0.21
41 0.18
42 0.18
43 0.22
44 0.17
45 0.17
46 0.15
47 0.17
48 0.17
49 0.16
50 0.17
51 0.11
52 0.11
53 0.1
54 0.12
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.08
61 0.07
62 0.08
63 0.11
64 0.12
65 0.13
66 0.13
67 0.13
68 0.14
69 0.16
70 0.16
71 0.22
72 0.26
73 0.3
74 0.38
75 0.43
76 0.49
77 0.5
78 0.54
79 0.47
80 0.48
81 0.45
82 0.43
83 0.46
84 0.44
85 0.48
86 0.43
87 0.46
88 0.48
89 0.5
90 0.49
91 0.52
92 0.57
93 0.62
94 0.71
95 0.77
96 0.8
97 0.89