Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3ALK1

Protein Details
Accession G3ALK1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-37YLWKKAPRLSPPQKYRLRKRMSLHydrophilic
86-110TAFNKHAKNYRKKLHLFPKWTKTSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG spaa:SPAPADRAFT_137154  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFQGSLVRCGGYLWKKAPRLSPPQKYRLRKRMSLVDENADAIYRGLIQAQGKAIGEPSGFRKVDYLKFEMPKENEMLPKDKYTAFNKHAKNYRKKLHLFPKWTKTSFRENPEHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.31
4 0.38
5 0.43
6 0.46
7 0.53
8 0.52
9 0.58
10 0.63
11 0.68
12 0.68
13 0.73
14 0.79
15 0.83
16 0.86
17 0.85
18 0.82
19 0.77
20 0.75
21 0.74
22 0.72
23 0.7
24 0.61
25 0.54
26 0.48
27 0.42
28 0.36
29 0.27
30 0.19
31 0.11
32 0.09
33 0.05
34 0.05
35 0.04
36 0.06
37 0.06
38 0.07
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.1
48 0.15
49 0.15
50 0.15
51 0.17
52 0.19
53 0.24
54 0.27
55 0.29
56 0.27
57 0.3
58 0.31
59 0.35
60 0.34
61 0.31
62 0.29
63 0.27
64 0.26
65 0.26
66 0.28
67 0.25
68 0.25
69 0.25
70 0.25
71 0.28
72 0.3
73 0.36
74 0.38
75 0.45
76 0.47
77 0.54
78 0.6
79 0.65
80 0.7
81 0.71
82 0.75
83 0.76
84 0.77
85 0.79
86 0.81
87 0.81
88 0.8
89 0.8
90 0.81
91 0.8
92 0.78
93 0.74
94 0.68
95 0.69
96 0.68
97 0.67