Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CC34

Protein Details
Accession A0A0K3CC34    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
182-204PNPYAPVRRPPRKSFKPRFERVVHydrophilic
NLS Segment(s)
PositionSequence
124-199RKAAAARGIKESALRGPGAGGPGGPRFGGPRPGGPGGPGGARFGGPRRGGQGAGPGGAPNPYAPVRRPPRKSFKPR
Subcellular Location(s) mito 20, extr 4, nucl 2
Family & Domain DBs
Amino Acid Sequences MTLLTPTVSLVRPAARALASTSSQSCGARSLARAFSTSRTVSDDTARDRSADTVGAIRARPISLKKAAEAAGSTETLIAQALERTSRPPVSATERRPTAGVGAIQAPRAPGMHREELQRLLAERKAAAARGIKESALRGPGAGGPGGPRFGGPRPGGPGGPGGARFGGPRRGGQGAGPGGAPNPYAPVRRPPRKSFKPRFERVVSEYKPPWTKEELTPRKPPATIDTPKLELDALVAADTYVRNSIAEQICKEVKLKPFSSDPKERAAAEKIFQGDYSQWVVQAPGKGKDSKDEVLARAMEGLMHNPSNSPPSSANLAPFTTEGNDLLGHAVTTGPPYESGNDAGNPQEPGGGARDSSNAPPLSGSGSSSDPYIVNPALSTLEQPGGGAVGRSDRGLVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.19
4 0.21
5 0.23
6 0.21
7 0.23
8 0.24
9 0.23
10 0.25
11 0.25
12 0.22
13 0.2
14 0.21
15 0.21
16 0.23
17 0.27
18 0.29
19 0.29
20 0.31
21 0.3
22 0.31
23 0.34
24 0.32
25 0.27
26 0.28
27 0.29
28 0.29
29 0.33
30 0.35
31 0.34
32 0.38
33 0.37
34 0.32
35 0.31
36 0.31
37 0.27
38 0.22
39 0.18
40 0.16
41 0.18
42 0.2
43 0.19
44 0.19
45 0.18
46 0.18
47 0.21
48 0.22
49 0.26
50 0.31
51 0.32
52 0.32
53 0.35
54 0.35
55 0.32
56 0.29
57 0.25
58 0.2
59 0.18
60 0.17
61 0.13
62 0.12
63 0.1
64 0.1
65 0.07
66 0.05
67 0.06
68 0.07
69 0.09
70 0.1
71 0.12
72 0.16
73 0.17
74 0.18
75 0.18
76 0.22
77 0.29
78 0.37
79 0.41
80 0.45
81 0.46
82 0.46
83 0.45
84 0.4
85 0.33
86 0.28
87 0.22
88 0.16
89 0.18
90 0.18
91 0.18
92 0.18
93 0.16
94 0.14
95 0.13
96 0.13
97 0.13
98 0.19
99 0.23
100 0.25
101 0.29
102 0.32
103 0.33
104 0.33
105 0.29
106 0.25
107 0.23
108 0.22
109 0.19
110 0.16
111 0.17
112 0.17
113 0.16
114 0.18
115 0.2
116 0.2
117 0.23
118 0.24
119 0.21
120 0.21
121 0.22
122 0.21
123 0.18
124 0.16
125 0.11
126 0.11
127 0.12
128 0.12
129 0.11
130 0.08
131 0.08
132 0.09
133 0.1
134 0.09
135 0.08
136 0.09
137 0.11
138 0.18
139 0.17
140 0.18
141 0.22
142 0.23
143 0.23
144 0.22
145 0.21
146 0.15
147 0.15
148 0.14
149 0.1
150 0.09
151 0.09
152 0.09
153 0.11
154 0.16
155 0.16
156 0.16
157 0.18
158 0.19
159 0.19
160 0.19
161 0.22
162 0.16
163 0.15
164 0.15
165 0.12
166 0.11
167 0.11
168 0.11
169 0.05
170 0.07
171 0.08
172 0.1
173 0.11
174 0.2
175 0.3
176 0.38
177 0.45
178 0.51
179 0.6
180 0.69
181 0.79
182 0.8
183 0.81
184 0.83
185 0.81
186 0.8
187 0.72
188 0.65
189 0.59
190 0.59
191 0.5
192 0.45
193 0.41
194 0.39
195 0.4
196 0.37
197 0.35
198 0.29
199 0.31
200 0.32
201 0.42
202 0.47
203 0.48
204 0.55
205 0.55
206 0.52
207 0.5
208 0.45
209 0.39
210 0.39
211 0.36
212 0.34
213 0.33
214 0.33
215 0.32
216 0.32
217 0.26
218 0.16
219 0.13
220 0.1
221 0.07
222 0.05
223 0.05
224 0.04
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.13
233 0.15
234 0.17
235 0.17
236 0.21
237 0.22
238 0.23
239 0.24
240 0.22
241 0.25
242 0.3
243 0.3
244 0.3
245 0.36
246 0.43
247 0.49
248 0.52
249 0.48
250 0.47
251 0.48
252 0.46
253 0.42
254 0.4
255 0.35
256 0.28
257 0.28
258 0.25
259 0.23
260 0.22
261 0.19
262 0.15
263 0.15
264 0.17
265 0.14
266 0.13
267 0.12
268 0.14
269 0.15
270 0.19
271 0.19
272 0.2
273 0.23
274 0.26
275 0.26
276 0.3
277 0.32
278 0.3
279 0.33
280 0.32
281 0.3
282 0.31
283 0.3
284 0.26
285 0.21
286 0.19
287 0.14
288 0.11
289 0.12
290 0.11
291 0.11
292 0.11
293 0.11
294 0.12
295 0.16
296 0.16
297 0.17
298 0.15
299 0.18
300 0.23
301 0.23
302 0.25
303 0.23
304 0.23
305 0.21
306 0.2
307 0.19
308 0.16
309 0.15
310 0.13
311 0.11
312 0.11
313 0.1
314 0.11
315 0.09
316 0.08
317 0.07
318 0.07
319 0.06
320 0.07
321 0.08
322 0.07
323 0.08
324 0.1
325 0.11
326 0.13
327 0.15
328 0.16
329 0.16
330 0.16
331 0.17
332 0.18
333 0.17
334 0.15
335 0.14
336 0.12
337 0.13
338 0.15
339 0.14
340 0.12
341 0.13
342 0.15
343 0.16
344 0.18
345 0.23
346 0.2
347 0.2
348 0.2
349 0.19
350 0.21
351 0.19
352 0.18
353 0.14
354 0.16
355 0.16
356 0.16
357 0.17
358 0.13
359 0.14
360 0.18
361 0.15
362 0.14
363 0.13
364 0.14
365 0.15
366 0.15
367 0.16
368 0.14
369 0.15
370 0.14
371 0.14
372 0.13
373 0.12
374 0.11
375 0.1
376 0.08
377 0.11
378 0.12
379 0.12
380 0.13